BYKdb

Annotate results for A0A0P9QD19

A0A0P9QD19 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P9QD19
DOMAINcd196/384SSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLR
CTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYELILIDTPPILAVTD
ATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
YGYNYHPAP
SITEWalker A203/205GKS
SITEWalker A'223/230LLIDADMR
SITEWalker B303/309ILIDTPP
SITEY Cluster371/380YDYAAYGYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGL
                                   SSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGL
                                          GKS                 LLIDADMR          
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYELILIDTPPILAVTDATLVG
QPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYELILIDTPPILAVTDATLVG
                                                              ILIDTPP           
       330       340       350       360       370       380     
....:....|....:....|....:....|....:....|....:....|....:....|....:
RQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
RQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAP 
                                                  YDYAAYGYNY     
© 1998-2019