BYKdb

Annotate results for A0A0P9SPP5

A0A0P9SPP5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0P9SPP5
DOMAINcd461/649SSPTPGAGKSFVSSNLAPIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLR
CTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTD
ATLVGRQAGTCLLAARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
YGYNYHPAP
SITEWalker A468/470GKS
SITEWalker A'488/495LLIDADMR
SITEWalker B568/574ILIDTPP
SITEY Cluster636/645YDYAAYGYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGIKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDS


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLAPII
                                                            SSPTPGAGKSFVSSNLAPII
                                                                   GKS          
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAE
AQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAE
       LLIDADMR                                                                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSPLYDLILIDTPPILAVTDATLVGRQAGTCLLAARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
LSPLYDLILIDTPPILAVTDATLVGRQAGTCLLAARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
       ILIDTPP                                                             YDYAA
       650
....:....|
YGYNYHPAPR
YGYNYHPAP 
YGYNY     
© 1998-2019