BYKdb

Annotate results for A0A0Q0AUD0

A0A0Q0AUD0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q0AUD0
DOMAINtad49/308PSFPEFPSGLPDRSGNSPADAVRSQDPDPVDRRRVFPDRPGLCHSGHTGVSGHRHDSDRA
SENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGAYLYRTFKP
ARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLL
GGAINRVVEGHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYL
SIEDQDAQRANRILDEVSHL
DOMAINcd584/772SSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLLGLQPKHGLSDTLAARLR
CTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTD
ATLVGRQAGTCLLVARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAA
YGYNYHPAP
SITEWalker A591/593GKS
SITEWalker A'611/618LLIDADMR
SITEWalker B691/697ILIDTPP
SITEY Cluster759/768YDCAAYGYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
                                                PSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGA
RRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHG
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHL            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGQESKLLSIAAPAELAIE


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLLGLQPKHGLSDTLAA
                       SSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLLGLQPKHGLSDTLAA
                              GKS                 LLIDADMR                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
                                                  ILIDTPP                       
       730       740       750       760       770   
....:....|....:....|....:....|....:....|....:....|...
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAP 
                                      YDCAAYGYNY     

© 1998-2019