BYKdb

Annotate results for A0A0Q0D3D2

A0A0Q0D3D2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q0D3D2
DOMAINcd399/587SSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLR
CTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTD
ATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
YGYNYHPAP
SITEWalker A406/408GKS
SITEWalker A'426/433LLIDADMR
SITEWalker B506/512ILIDTPP
SITEY Cluster574/583YDYAAYGYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FQRLPKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQEAQRANRILDEVSHIYVRQNVERSSAEAAQRLQFLRS


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQGLLKKIDALPMTQQELLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISS
                                                                              SS

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAA
PTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAA
     GKS                 LLIDADMR                                               
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGA
PNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGA
                         ILIDTPP                                                
       570       580        
....:....|....:....|....:...
IFNAVVRKATTSDYDYAAYGYNYHPAPR
IFNAVVRKATTSDYDYAAYGYNYHPAP 
             YDYAAYGYNY     
© 1998-2019