BYKdb

Annotate results for A0A0Q0PCA3

A0A0Q0PCA3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q0PCA3
DOMAINtad18/195QIVDFKKMFKPLFRYKWRILTFSVLVSVLVSFFLLSMTPIFSATSTLLIESEQAKAIKID
EVYGINSGQQEYYLTQFEIIKSRTIAERVFNDLDLINHPTFNQPPSLLSQLKSNLKFVPK
EQAGEFNVDENAVKQRLIEGFSKNISVSPVRNTQLVKISYESPDANLAALVSNAIGDT
DOMAINcd540/730TSSVPNEGKTNVSMNLAFAYSTMEKVLLIDADLRKSSLGVRFGLPTYQPGLANLLAKTDT
VENCIISDIKPNVDIMPAGAIPLNPQELLSSETFADLLAELKKSYTKIIIDTPPVHAVSD
ALVISSKCDAVVVVVKSANTRIDAIKMTLAKINQARGKVVGVVLNQFNTKEAKHYNGDYG
YYQAYGQDYAI
SITEWalker A547/549GKT
SITEWalker A'566/573LLIDADLR
SITEWalker B647/653IIIDTPP
SITEY Cluster714/728YNGDYGYYQAYGQDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIQNDNQATSFLQQPMDQIVDFKKMFKPLFRYKWRILTFSVLVSVLVSFFLLSMTPIFSATSTLLIESEQAKAIKIDEVY
                 QIVDFKKMFKPLFRYKWRILTFSVLVSVLVSFFLLSMTPIFSATSTLLIESEQAKAIKIDEVY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GINSGQQEYYLTQFEIIKSRTIAERVFNDLDLINHPTFNQPPSLLSQLKSNLKFVPKEQAGEFNVDENAVKQRLIEGFSK
GINSGQQEYYLTQFEIIKSRTIAERVFNDLDLINHPTFNQPPSLLSQLKSNLKFVPKEQAGEFNVDENAVKQRLIEGFSK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NISVSPVRNTQLVKISYESPDANLAALVSNAIGDTYILSQLEAKSGMTHKANVWLGGRLEELRLKLDESENRLEEFKINN
NISVSPVRNTQLVKISYESPDANLAALVSNAIGDT                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLIDVEGVTALDAKELESLRDEITLARSRKAQADSFMSVVQRYGATDISRLESLPEVTSHQSIQNVKREVVLVERKVSEL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQVYGPKHPKMIAAYAELATVEKNLHRQITRLVQGIEDEAKTAAQKLQDLQAQFNDSKGSYQNLSSIDTDYRRLVREIDT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQQLFESFLARQKETEVTGDFDSPIARFTDRAVVPLLPVKPKKKVLVLLTFFASLVFGGVVVLLLEALNDTVKSNEDVEK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLAQRALGYIPKANKKASFEDINFAFYDKNLPLHSEAVRTIRTSISLMSIGSDLNTIEVTSSVPNEGKTNVSMNLAFAYS
                                                           TSSVPNEGKTNVSMNLAFAYS
                                                                  GKT           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMEKVLLIDADLRKSSLGVRFGLPTYQPGLANLLAKTDTVENCIISDIKPNVDIMPAGAIPLNPQELLSSETFADLLAEL
TMEKVLLIDADLRKSSLGVRFGLPTYQPGLANLLAKTDTVENCIISDIKPNVDIMPAGAIPLNPQELLSSETFADLLAEL
     LLIDADLR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKSYTKIIIDTPPVHAVSDALVISSKCDAVVVVVKSANTRIDAIKMTLAKINQARGKVVGVVLNQFNTKEAKHYNGDYGY
KKSYTKIIIDTPPVHAVSDALVISSKCDAVVVVVKSANTRIDAIKMTLAKINQARGKVVGVVLNQFNTKEAKHYNGDYGY
      IIIDTPP                                                            YNGDYGY
       730        
....:....|....:...
YQAYGQDYAIKQDNEKAS
YQAYGQDYAI        
YQAYGQDY          

© 1998-2019