BYKdb

Annotate results for A0A0Q0TXL5

A0A0Q0TXL5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q0TXL5
DOMAINcd55/241TSAEAAEGKSTVSGNLALAFAQNEKRVIIVDCDLRKPSVHKNFKVSNLCGLSEVLIGKSE
LNNVIQNRNEHLDILTSGKIPPNPSEMLSSSAMTKLIETLKEEYDVIILDSAPLGAVTDA
QILSTKVDGTILVTRAERTKREIVLEAKNSLEKVGANILGCVLHAVENTKGKYYYYYGTD
GEHKKKN
SITE-111/-113GKS
SITEWalker A'82/89IIVDCDLR
SITEWalker B161/167IILDSAP
SITEY Cluster227/231YYYYY
SITEWalker A62/64GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFFKSKLEKAVDNQKHMGFVMERKPKSVVSEAYRTLRTNIQYSSFDKKIQTIVVTSAEAAEGKSTVSGNLALAFAQNEKR
                                                      TSAEAAEGKSTVSGNLALAFAQNEKR
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIIVDCDLRKPSVHKNFKVSNLCGLSEVLIGKSELNNVIQNRNEHLDILTSGKIPPNPSEMLSSSAMTKLIETLKEEYDV
VIIVDCDLRKPSVHKNFKVSNLCGLSEVLIGKSELNNVIQNRNEHLDILTSGKIPPNPSEMLSSSAMTKLIETLKEEYDV
 IIVDCDLR                                                                       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IILDSAPLGAVTDAQILSTKVDGTILVTRAERTKREIVLEAKNSLEKVGANILGCVLHAVENTKGKYYYYYGTDGEHKKK
IILDSAPLGAVTDAQILSTKVDGTILVTRAERTKREIVLEAKNSLEKVGANILGCVLHAVENTKGKYYYYYGTDGEHKKK
IILDSAP                                                           YYYYY         
 
.
N
N

© 1998-2019