BYKdb

Annotate results for A0A0Q0YJS7

A0A0Q0YJS7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q0YJS7
DOMAINcd63/254SSALPSEGKSNVTANLAVVYAQQGKRVLLVDTDLRRPTVARTFGVTDNHGLTNYLADVNS
DMGSIVRHTRMSTLDVVASGPVPPNPAELLASSRMTNLITELRQQYDLIIFDVPPFLMVT
DAQVLMSKVDGVAIVVSGRHTTKGALQRTTDMLKLADAPMLGFIYNDRSRKKTSGSGYGY
GYGYGYGYGETK
SITEWalker A70/72GKS
SITEWalker A'90/97LLVDTDLR
SITEWalker B171/177IIFDVPP
SITEY Cluster240/250YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVFFKKKYKTGRDGLSVETMMEGARLIAAAEPKNPVSEQFRTIRTNIDFAAVAKGNVKTLLVSSALPSEGKSNVTANLAV
                                                              SSALPSEGKSNVTANLAV
                                                                     GKS        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYAQQGKRVLLVDTDLRRPTVARTFGVTDNHGLTNYLADVNSDMGSIVRHTRMSTLDVVASGPVPPNPAELLASSRMTNL
VYAQQGKRVLLVDTDLRRPTVARTFGVTDNHGLTNYLADVNSDMGSIVRHTRMSTLDVVASGPVPPNPAELLASSRMTNL
         LLVDTDLR                                                               
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITELRQQYDLIIFDVPPFLMVTDAQVLMSKVDGVAIVVSGRHTTKGALQRTTDMLKLADAPMLGFIYNDRSRKKTSGSGY
ITELRQQYDLIIFDVPPFLMVTDAQVLMSKVDGVAIVVSGRHTTKGALQRTTDMLKLADAPMLGFIYNDRSRKKTSGSGY
          IIFDVPP                                                              Y
       250    
....:....|....
GYGYGYGYGYGETK
GYGYGYGYGYGETK
GYGYGYGYGY    
© 1998-2019