BYKdb

Annotate results for A0A0Q1AVE5

A0A0Q1AVE5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q1AVE5
DOMAINtad12/241FNLMKNSIIRAAIRYRWLIFAIFFITTLGAMVSSSRLVDIYSATATLRFQSETGQATRSL
GIWNQMMYYNYRWDMDPIADQIALIRSRSVAEGVVRRLNAYYYLVNKSFKNSHSVNLDVL
WLNENHRYSNYWFKFQKDSTFEVFAEETIYIASGKIGDTLNFNFASVYLTLNYPDTGTVI
FGFIPIEKAAEGMRGRLSVSGIEQTNILAITVSDPNPHRAREVVNAFARE
DOMAINcd630/820SSALPKEGKSTTVANLATTFAQQGLKTLVVDTDLRKPVMHHVFDSPRTPGIVEYLLKINQ
LDEVVRNTGIENLDLISCGTIPPNPSEVIASENMNSFIDTVKQQYDIIIFDSSPLLAVTD
ASLLSTKTDGTILVIRAEKTDREAAKAALKLLKNVKSEIKGSILNNVVIGAKYGYNYYYR
YYYQYYYGHGA
SITEWalker A637/639GKS
SITEWalker A'657/664LVVDTDLR
SITEWalker B737/743IIFDSSP
SITEY Cluster802/816YGYNYYYRYYYQYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPEDNQQQSNEFNLMKNSIIRAAIRYRWLIFAIFFITTLGAMVSSSRLVDIYSATATLRFQSETGQATRSLGIWNQMMYY
           FNLMKNSIIRAAIRYRWLIFAIFFITTLGAMVSSSRLVDIYSATATLRFQSETGQATRSLGIWNQMMYY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NYRWDMDPIADQIALIRSRSVAEGVVRRLNAYYYLVNKSFKNSHSVNLDVLWLNENHRYSNYWFKFQKDSTFEVFAEETI
NYRWDMDPIADQIALIRSRSVAEGVVRRLNAYYYLVNKSFKNSHSVNLDVLWLNENHRYSNYWFKFQKDSTFEVFAEETI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YIASGKIGDTLNFNFASVYLTLNYPDTGTVIFGFIPIEKAAEGMRGRLSVSGIEQTNILAITVSDPNPHRAREVVNAFAR
YIASGKIGDTLNFNFASVYLTLNYPDTGTVIFGFIPIEKAAEGMRGRLSVSGIEQTNILAITVSDPNPHRAREVVNAFAR

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIVSFDVQRSRGAARSVREFIEQQLLITNTSLEEAERNLRSIQEKYGWLTASREEMRVEQQLADLVGQRVAAMITVKELE
E                                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKLWSLKSELQGQGAFNIYSDAQTIPELSSNPALNAIQEQINKYEIEKAELLGSYTENHPRIRQIDSIVQFLKGELVTSI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDNLSQYGSGPIDQVWSNLASQYIMTEVELASARALLGALEAAIEDIRTELDSLPEEIAMFERAYRQVEVEKQTYTTLLV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLQEAKISEATQVGNVSLVDTALTPTRPIGPNRKKNIIIGAFVGLLLGFGLAYLLEKLDTTIRDVEEIEDYLGLNVLGIV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNITEKEIDQHRKIMEGGEEESEQMIGENIQSHLITHAAPKSPISEAYRTIRTNIQFSSVTKPTKTLIISSALPKEGKST
                                                                     SSALPKEGKST
                                                                            GKS 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVANLATTFAQQGLKTLVVDTDLRKPVMHHVFDSPRTPGIVEYLLKINQLDEVVRNTGIENLDLISCGTIPPNPSEVIAS
TVANLATTFAQQGLKTLVVDTDLRKPVMHHVFDSPRTPGIVEYLLKINQLDEVVRNTGIENLDLISCGTIPPNPSEVIAS
                LVVDTDLR                                                        
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENMNSFIDTVKQQYDIIIFDSSPLLAVTDASLLSTKTDGTILVIRAEKTDREAAKAALKLLKNVKSEIKGSILNNVVIGA
ENMNSFIDTVKQQYDIIIFDSSPLLAVTDASLLSTKTDGTILVIRAEKTDREAAKAALKLLKNVKSEIKGSILNNVVIGA
                IIFDSSP                                                         
       810       820       830       840   
....:....|....:....|....:....|....:....|...
KYGYNYYYRYYYQYYYGHGATNKFRKRKSLRQNWWIKIKEFFN
KYGYNYYYRYYYQYYYGHGA                       
 YGYNYYYRYYYQYYY                           

© 1998-2019