BYKdb

Annotate results for A0A0Q3BEY5

A0A0Q3BEY5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q3BEY5
DOMAINtad1/135MTLLDFLRLTRANLKYLIIFTVAGALLGLGVAALQPKVYSATSSGYVTAGGGSAVGDILS
GDSAAQAKASAYLPLVTSGPVAKKIAENNSVGIDESAIPSHLSASVEPNSTLIKVTATAS
SPQDAATLANNALQA
DOMAINcd262/450SSPNPGEGKSTVSASLAHAFAKAGQPTILIDADLRRPTQAKIFGLDDAVGLSQVLSGQIG
PEEAIQRIGDTELYVLPAGRIPPNPSELLGSSKMQRLIQEMSQEYLVIIDVPPLLPVTDG
SLLSANVDGAILVNVCGRTRKDQAQAAAQALGRVNGHLLGTVMNMTPEKGLGSHYYGFGY
GGYRSGYQA
SITEWalker A269/271GKS
SITEWalker A'289/296ILIDADLR
SITEWalker B368/374VIIDVPP
SITEY Cluster436/452YYGFGYGGYRSGYQAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLLDFLRLTRANLKYLIIFTVAGALLGLGVAALQPKVYSATSSGYVTAGGGSAVGDILSGDSAAQAKASAYLPLVTSGP
MTLLDFLRLTRANLKYLIIFTVAGALLGLGVAALQPKVYSATSSGYVTAGGGSAVGDILSGDSAAQAKASAYLPLVTSGP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAKKIAENNSVGIDESAIPSHLSASVEPNSTLIKVTATASSPQDAATLANNALQATADYVSDLEGRESAVKVTPLDDAQA
VAKKIAENNSVGIDESAIPSHLSASVEPNSTLIKVTATASSPQDAATLANNALQA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDGPVSPSYRNYLLIGAAVGLVLAYLIAFLRKFADVRVRTTDDLENATEAGTLGILPKSSALDENTFLSDRADHQSEEAL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQLRTNLRFVSVDAPPRSIIVSSPNPGEGKSTVSASLAHAFAKAGQPTILIDADLRRPTQAKIFGLDDAVGLSQVLSGQI
                     SSPNPGEGKSTVSASLAHAFAKAGQPTILIDADLRRPTQAKIFGLDDAVGLSQVLSGQI
                            GKS                 ILIDADLR                        
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPEEAIQRIGDTELYVLPAGRIPPNPSELLGSSKMQRLIQEMSQEYLVIIDVPPLLPVTDGSLLSANVDGAILVNVCGRT
GPEEAIQRIGDTELYVLPAGRIPPNPSELLGSSKMQRLIQEMSQEYLVIIDVPPLLPVTDGSLLSANVDGAILVNVCGRT
                                               VIIDVPP                          
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKDQAQAAAQALGRVNGHLLGTVMNMTPEKGLGSHYYGFGYGGYRSGYQAYYGQDGEGSGSGSSPAAGGKHGAKGRGRRA
RKDQAQAAAQALGRVNGHLLGTVMNMTPEKGLGSHYYGFGYGGYRSGYQA                              
                                   YYGFGYGGYRSGYQAYY                            
      
....:.
RTSHSS


© 1998-2019