BYKdb

Annotate results for A0A0Q3W8A8

A0A0Q3W8A8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q3W8A8
DOMAINcd50/231TSSEPSEGKTTTIANLAVTYAQQEKKVLLVDADLRKPQLHSDFKLENFKGLTTAIAQEKS
LKDVIQKTDISNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQYDVILFDAPPLLAVTD
AQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGS
EK
SITEWalker A57/59GKT
SITEWalker A'77/84LLVDADLR
SITEWalker B157/163ILFDAPP
SITE-151/-154YEQY
SITEY Cluster223/227YYDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVRKMAKESLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKIKSILVTSSEPSEGKTTTIANLAVTYAQQEKKVLLVD
                                                 TSSEPSEGKTTTIANLAVTYAQQEKKVLLVD
                                                        GKT                 LLVD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRKPQLHSDFKLENFKGLTTAIAQEKSLKDVIQKTDISNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQYDVILFD
ADLRKPQLHSDFKLENFKGLTTAIAQEKSLKDVIQKTDISNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQYDVILFD
ADLR                                                                        ILFD
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGSEK
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGSEK
APP                                                           YYDYY    
© 1998-2019