BYKdb

Annotate results for A0A0Q3WXV3

A0A0Q3WXV3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q3WXV3
DOMAINcd54/233TSPEPADGKTTTSANLSIVLAQQGKRVILVDSDLRKPSVHYSFNISNLHGLTNVLTREIS
LENAILKTHIHNLEVLTSGPIPPNPSELLESKAMELLIYQLHSGFDYVVFDTPPILAVSD
SQILANKCDGVIMVVSSGKTRKDAALKSKNILLQANARLIGVVMNGIEQKRREDYYQYGP
SITE-191/-193GKT
SITEWalker A'81/88ILVDSDLR
SITEWalker B161/167VVFDTPP
SITEY Cluster228/231YYQY
SITEWalker A61/63GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRQLLRKHKNIVKDEIKLITYYQPQSYITEQYRLLKNNIQFSSVDKEIKTIVVTSPEPADGKTTTSANLSIVLAQQGKRV
                                                     TSPEPADGKTTTSANLSIVLAQQGKRV
                                                            GKT                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILVDSDLRKPSVHYSFNISNLHGLTNVLTREISLENAILKTHIHNLEVLTSGPIPPNPSELLESKAMELLIYQLHSGFDY
ILVDSDLRKPSVHYSFNISNLHGLTNVLTREISLENAILKTHIHNLEVLTSGPIPPNPSELLESKAMELLIYQLHSGFDY
ILVDSDLR                                                                        
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
VVFDTPPILAVSDSQILANKCDGVIMVVSSGKTRKDAALKSKNILLQANARLIGVVMNGIEQKRREDYYQYGP
VVFDTPPILAVSDSQILANKCDGVIMVVSSGKTRKDAALKSKNILLQANARLIGVVMNGIEQKRREDYYQYGP
VVFDTPP                                                            YYQY  
© 1998-2019