BYKdb

Annotate results for A0A0Q4CFJ9

A0A0Q4CFJ9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q4CFJ9
DOMAINcd400/589TSTRPAEGKSTTALALATMLARSGKRVILVDGDMRSPSVHHLGGVNHDHGLSNFLAGQED
IAPLTFDMADLGFTAMSAGPIPPNAAELLTGNRLSLLIERLHEHFDHVVIDSPPVMGLAD
APLIASRVEGVVYAVESHGIRSTLVKTALARLAAANAHIFGGVLTKFEARKAHYGYGYEY
GYGYGREKAT
SITEWalker A407/409GKS
SITEWalker A'427/434ILVDGDMR
SITEWalker B507/513VVIDSPP
SITEY Cluster573/583YGYGYEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVNGRYPASGRATRQRVAGEILIDHLAIVPTRLSRLVDIRFTSPNPEFSAKIVNTWSDAFIQTNLERKVQATSYGRNLLQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQLAQQKERLDESQRQLVTYASQERIINLPAQSNADGSTAERSIVADDLASLNTALSQATAERIAAESRYREGSRAGASS


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EALRNQAINSLRQRRAEYAAEYQKLLTQFEPEYPAAKALKSQIDQLDRSITNEERRVSGSIETDYRGAVERERALQARVE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLKSSYLDLRRRSIQYNIFQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNVAVVDQADVPQHPSSPRLLINLAIALVAGL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIGAALAFALEQMDEAIADPGEVERRLGLPLLGSVPKVENVTPKEALLDRKSELVDAYLAIQTNLAFTTEHGVPRSLSVT
                                                                               T

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STRPAEGKSTTALALATMLARSGKRVILVDGDMRSPSVHHLGGVNHDHGLSNFLAGQEDIAPLTFDMADLGFTAMSAGPI
STRPAEGKSTTALALATMLARSGKRVILVDGDMRSPSVHHLGGVNHDHGLSNFLAGQEDIAPLTFDMADLGFTAMSAGPI
      GKS                 ILVDGDMR                                              
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPNAAELLTGNRLSLLIERLHEHFDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSTLVKTALARLAAANAHIFG
PPNAAELLTGNRLSLLIERLHEHFDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSTLVKTALARLAAANAHIFG
                          VVIDSPP                                               
       570       580       590   
....:....|....:....|....:....|...
GVLTKFEARKAHYGYGYEYGYGYGREKATEAKG
GVLTKFEARKAHYGYGYEYGYGYGREKAT    
            YGYGYEYGYGY          
© 1998-2019