BYKdb

Annotate results for A0A0Q4GIY3

A0A0Q4GIY3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4GIY3
DOMAINtad26/185RLIDLHRIFGIARRRRWWIVATVVIILVLTAVAYTMVPRRYMGTASIALDRRADQIIAGQ
SPNQELPTDSPTVDTAVEVLTSPSLAARVVDTLNLQREPGFGQAIDGPVLSPAAARSRAI
SKVQSGLAVKRTGLSYAIDTSFTWTDPKHAAAVVNALVDE
DOMAINcd530/718SSALPGEGKTTISICLARSAALAGAKVVVIDCDVRRRTFSRSVTNDTAVGLIEVLDGTAQ
LDKALLHDTASGAYILPQSNTKSMNYELVASQAMFSLIQSLSERFDLVLLDTPPVLPLAE
ARAIAAMADGVLFVTRWRKTPANASELAVDMLAREGAKIYGVALSQVNLKQQSRAGFGDE
MSYYHRFKG
SITEWalker A537/539GKT
SITEWalker A'557/564VVIDCDVR
SITEWalker B637/643VLLDTPP
SITEY Cluster712/720YYHRFKGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNGDTRMAAKTNTLSDELHEGESDARLIDLHRIFGIARRRRWWIVATVVIILVLTAVAYTMVPRRYMGTASIALDRRADQ
                         RLIDLHRIFGIARRRRWWIVATVVIILVLTAVAYTMVPRRYMGTASIALDRRADQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIAGQSPNQELPTDSPTVDTAVEVLTSPSLAARVVDTLNLQREPGFGQAIDGPVLSPAAARSRAISKVQSGLAVKRTGLS
IIAGQSPNQELPTDSPTVDTAVEVLTSPSLAARVVDTLNLQREPGFGQAIDGPVLSPAAARSRAISKVQSGLAVKRTGLS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YAIDTSFTWTDPKHAAAVVNALVDEYIASQRDTKVDSRTNDNKLLRERLSRLRDEVIRAETAEAQYRANTNLIDVQKDST
YAIDTSFTWTDPKHAAAVVNALVDE                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVQQELSFLNTQLATAQADQAAAEARLRAARGGGGNAAADFGSPVIRSLRQQQAQLSAQRADLAGRYGPLHPDLAKLDRQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YADVNNSIRDETRRTLAGLVADARVSAGRTSAIRSSLDRAQGGLQAGNRASVQLNELQRNADSARGLYQAFLDRYRQSVA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEGTDKSNASVISRAMVPGGPVFPNAAVFGAGGILASLLAAVGVVLLLELLESGFQNRRQVEARLHVPVIGTVPDLATIP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GARISKRDPMAPANFLVENQGSLFSESFRSIRSALKIGRPDQVVRSLAVSSALPGEGKTTISICLARSAALAGAKVVVID
                                                 SSALPGEGKTTISICLARSAALAGAKVVVID
                                                        GKT                 VVID
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CDVRRRTFSRSVTNDTAVGLIEVLDGTAQLDKALLHDTASGAYILPQSNTKSMNYELVASQAMFSLIQSLSERFDLVLLD
CDVRRRTFSRSVTNDTAVGLIEVLDGTAQLDKALLHDTASGAYILPQSNTKSMNYELVASQAMFSLIQSLSERFDLVLLD
CDVR                                                                        VLLD
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPPVLPLAEARAIAAMADGVLFVTRWRKTPANASELAVDMLAREGAKIYGVALSQVNLKQQSRAGFGDEMSYYHRFKGYY
TPPVLPLAEARAIAAMADGVLFVTRWRKTPANASELAVDMLAREGAKIYGVALSQVNLKQQSRAGFGDEMSYYHRFKG  
TPP                                                                    YYHRFKGYY
    
....
AEAG


© 1998-2019