BYKdb

Annotate results for A0A0Q4HBI5

A0A0Q4HBI5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4HBI5
DOMAINtad1/135MELRDYIRILRQSWVLIVLLTLFGVAAGAVFSILQTPMYSSSAKVFVSTSNGGTIGEMAQ
GNTYTQQRVKTYADLTTTPIVLLPVIADLQLDMTSDELAREVTAVTLPDTTLIEITVTDE
NAALTAEVATAVSES
DOMAINcd278/465TSSIESEGKSTTAANLAIALADAGARVLLVDADLRRPKVASYLGIEGAVGLTDLLIGRAE
LQDVIQPWGRSQMYVLPAGRVPPNPSELLGSQVMAETVKELNRAFDVVLFDAPPLLPVTD
AAVLSRAAGGAILVVAVGRAHKGQVKGAFSVLENVDANVSGIVLTMLPMKGPDAYGYGRY
GYGYGYGY
SITEWalker A285/287GKS
SITEWalker A'305/312LLVDADLR
SITEWalker B385/391VLFDAPP
SITEY Cluster452/467YGYGRYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYIRILRQSWVLIVLLTLFGVAAGAVFSILQTPMYSSSAKVFVSTSNGGTIGEMAQGNTYTQQRVKTYADLTTTPI
MELRDYIRILRQSWVLIVLLTLFGVAAGAVFSILQTPMYSSSAKVFVSTSNGGTIGEMAQGNTYTQQRVKTYADLTTTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVIADLQLDMTSDELAREVTAVTLPDTTLIEITVTDENAALTAEVATAVSESLTNVVSAIETTGANAEDTGEDGAPA
VLLPVIADLQLDMTSDELAREVTAVTLPDTTLIEITVTDENAALTAEVATAVSES                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EASPVRLTLVQHASVPQKPVSPNVMLNIVLGGLIGLALGVGAAVLRETLDTRIRNERDIEQVTDAPVIGGIVFDPKAKDR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLIVHADPHSPRAESFRALRTNLQFLDAGRPDRSFVVTSSIESEGKSTTAANLAIALADAGARVLLVDADLRRPKVASYL
                                     TSSIESEGKSTTAANLAIALADAGARVLLVDADLRRPKVASYL
                                            GKS                 LLVDADLR        
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIEGAVGLTDLLIGRAELQDVIQPWGRSQMYVLPAGRVPPNPSELLGSQVMAETVKELNRAFDVVLFDAPPLLPVTDAAV
GIEGAVGLTDLLIGRAELQDVIQPWGRSQMYVLPAGRVPPNPSELLGSQVMAETVKELNRAFDVVLFDAPPLLPVTDAAV
                                                                VLFDAPP         
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSRAAGGAILVVAVGRAHKGQVKGAFSVLENVDANVSGIVLTMLPMKGPDAYGYGRYGYGYGYGYGYAPKEEPKQETAAG
LSRAAGGAILVVAVGRAHKGQVKGAFSVLENVDANVSGIVLTMLPMKGPDAYGYGRYGYGYGYGY               
                                                   YGYGRYGYGYGYGYGY             
 
.
A


© 1998-2019