BYKdb

Annotate results for A0A0Q4I3V6

A0A0Q4I3V6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4I3V6
DOMAINtad34/214DRIDARALVAMFRRRLGIFLLVFLSILIIGLALTFRQTPSYTAVAQVSLNVKQSALTPAG
VGERPDLDRAEPSANFVDTQVEIIRSEAFARRVASALALPTDPRFTSLQEPRGIRTWITS
WFTAPPKVARPTAAEAEAAAITYVQDGVTATRLNSTYALHISFSDTDPAMAARIVNEFAR
Q
DOMAINcd557/745TSALAQEGKTTTSICLARSMGLAGEKVVLVDCDLRRHGVSRFLRTEADRPGLMQVLRGEA
TLEAALVEDTATGMMVLPIAADDDFDGDLMIGDKMDGLLDALRDRFDVIVLDTAPVLPIA
DARLMLGKADVAVFVARWRKTPDHAIRSALRLLPLDRIHLAGIALTKVDIRKQARFGYGD
STYYYHDYK
SITEWalker A564/566GKT
SITEWalker A'584/591VLVDCDLR
SITEWalker B665/671IVLDTAP
SITEY Cluster734/748YGDSTYYYHDYKGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MENEQVTTAIQVYGGGNAMPISPYTPQASEVAQDRIDARALVAMFRRRLGIFLLVFLSILIIGLALTFRQTPSYTAVAQV
                                 DRIDARALVAMFRRRLGIFLLVFLSILIIGLALTFRQTPSYTAVAQV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLNVKQSALTPAGVGERPDLDRAEPSANFVDTQVEIIRSEAFARRVASALALPTDPRFTSLQEPRGIRTWITSWFTAPPK
SLNVKQSALTPAGVGERPDLDRAEPSANFVDTQVEIIRSEAFARRVASALALPTDPRFTSLQEPRGIRTWITSWFTAPPK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VARPTAAEAEAAAITYVQDGVTATRLNSTYALHISFSDTDPAMAARIVNEFARQYTEGSLAKKQVENRDSTAMIARRAED
VARPTAAEAEAAAITYVQDGVTATRLNSTYALHISFSDTDPAMAARIVNEFARQ                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRARWQAADAAEQRYRIQHNLTSTQGLSLTEQEISTYNQAVAAARAALAEDQARLSTARAQLRSGSRGDDVGEALGSSVV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGLRANQSALSAQVAELTTRYGARHPDVLRANSQLAAIDKQISNEIARVISNLAAKTRVSEGRLASLSGTLSGAQAELAG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNAATVELNNLAQNNKTARSTYESYLTRYQEQLARLGTEQADASVLKLAAIPDTPTSPNILLNLILTTVLGFGFGLVAAF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTEMAFTGLTTGDDIEQRLGVRYLGAVPLLASVTKSAKSPPSAIAAEPRSAFAESIRSLRASITFAAHAPAKVIAITSAL
                                                                            TSAL

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQEGKTTTSICLARSMGLAGEKVVLVDCDLRRHGVSRFLRTEADRPGLMQVLRGEATLEAALVEDTATGMMVLPIAADDD
AQEGKTTTSICLARSMGLAGEKVVLVDCDLRRHGVSRFLRTEADRPGLMQVLRGEATLEAALVEDTATGMMVLPIAADDD
   GKT                 VLVDCDLR                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDGDLMIGDKMDGLLDALRDRFDVIVLDTAPVLPIADARLMLGKADVAVFVARWRKTPDHAIRSALRLLPLDRIHLAGIA
FDGDLMIGDKMDGLLDALRDRFDVIVLDTAPVLPIADARLMLGKADVAVFVARWRKTPDHAIRSALRLLPLDRIHLAGIA
                        IVLDTAP                                                 
       730       740         
....:....|....:....|....:....
LTKVDIRKQARFGYGDSTYYYHDYKGYYA
LTKVDIRKQARFGYGDSTYYYHDYK    
             YGDSTYYYHDYKGYY 

© 1998-2019