BYKdb

Annotate results for A0A0Q4IGG1

A0A0Q4IGG1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q4IGG1
DOMAINcd403/592TSTRPAEGKSTTALALATMLTRAGKRVILIDGDMRSPSVHELGGVDHDRGLSNFLAGDDA
IETLTFPMHDLGFVAMSAGPIPPNAAELLTGNRLSVLIERLLERFDHIVIDSPPVMGLAD
APLIASRVEGVVYAVESHGIRTTLVKTALHRLAAGNVRIFGGVLTKFESRKAHYGYGYEY
GYGYGRHEAK
SITEWalker A410/412GKS
SITEWalker A'430/437ILIDGDMR
SITEWalker B510/516IVIDSPP
SITEY Cluster576/586YGYGYEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVNGQYKAAGRAERQQLAGKILLDNISINPTRLSSLVDISFDSPDPILSTQIVNAWSDSFIQTNLERKVQATSYGRNMLQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQLALQKSRLDDSQRQLVAYASAQQIINLPAQGAGSGGSTTVERSIVADDLAALNATLSQATAERIQAQARAQQSGRAGA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STEALRNQAINTLRQRRAELAADYQRLMVQFEPGYPAARAIQTQIDQLDRSISREESRVTGSIQAEYREALQREGALQAR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNQLKSSYLDNRRRSIQYNIYQQEVDTNRALYDGLLQRYKEIGVAGNIGVNNISVVDAANVPQRPSSPRLLLNLLVSLLA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLAIGSLAAFALEQMDEAIADPAEVERQLGLPLLGSVPKVAGESSPRDQLLDRKSDLVDAYIAINTNLGFTTEHGVPRTF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVTSTRPAEGKSTTALALATMLTRAGKRVILIDGDMRSPSVHELGGVDHDRGLSNFLAGDDAIETLTFPMHDLGFVAMSA
  TSTRPAEGKSTTALALATMLTRAGKRVILIDGDMRSPSVHELGGVDHDRGLSNFLAGDDAIETLTFPMHDLGFVAMSA
         GKS                 ILIDGDMR                                           
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPIPPNAAELLTGNRLSVLIERLLERFDHIVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRTTLVKTALHRLAAGNVR
GPIPPNAAELLTGNRLSVLIERLLERFDHIVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRTTLVKTALHRLAAGNVR
                             IVIDSPP                                            
       570       580       590   
....:....|....:....|....:....|...
IFGGVLTKFESRKAHYGYGYEYGYGYGRHEAKS
IFGGVLTKFESRKAHYGYGYEYGYGYGRHEAK 
               YGYGYEYGYGY       
© 1998-2019