BYKdb

Annotate results for A0A0Q4IW22

A0A0Q4IW22 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4IW22
DOMAINtad14/177LADVVRTAKDVIRRRYLTLAAITLAVTAIGVFLTLRITPTYQGVAKIQIDPSRNPLTRNQ
SEANAQLASEAIETEVTNLGSMDLVRTVVRRLNLVNHPQFRGIWQARAEKTGPVSDTEKV
EMVAAAVRSDVSVSRDKLTYILLVRYSSPDADIAAKVANAMATA
DOMAINcd519/709TSALPSEGKTTTSLGLARTMAISGDRTILVDADVRRAMLRNILDTSSTGPGIVEVLHGEV
DLDQAIQPSGVENLDQILVQKPYFSSENMFGSGQMQTMLDELSKRYDTIILDLPPLVGLA
DGRFIAALADAVVLVIKWDTTPADAVISAADHLKSDGANLVGAMFTMVDQSSKAAGAYYY
YTKQYSSYYQT
SITEWalker A526/528GKT
SITEWalker A'546/553ILVDADVR
SITEWalker B627/633IILDLPP
SITEY Cluster696/707YYYYTKQYSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKVSNAAAGYETRLADVVRTAKDVIRRRYLTLAAITLAVTAIGVFLTLRITPTYQGVAKIQIDPSRNPLTRNQSEANAQL
             LADVVRTAKDVIRRRYLTLAAITLAVTAIGVFLTLRITPTYQGVAKIQIDPSRNPLTRNQSEANAQL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASEAIETEVTNLGSMDLVRTVVRRLNLVNHPQFRGIWQARAEKTGPVSDTEKVEMVAAAVRSDVSVSRDKLTYILLVRYS
ASEAIETEVTNLGSMDLVRTVVRRLNLVNHPQFRGIWQARAEKTGPVSDTEKVEMVAAAVRSDVSVSRDKLTYILLVRYS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPDADIAAKVANAMATAYLDNKVGSRIGTAERQSKWFESRMADLVQEVRVADERVAQYQAQAGIVRGASNNSGTITDQQV
SPDADIAAKVANAMATA                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPLSVQLASAESIAAEARSKQTSAQQQVSRGTLDTVSDVRNSATVQDLRRQRALLMQASAEMEGRYGNRHPDYLKVRDQL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGLDKQLAEESRRVVSSLRSDADAADARAASLRSSMRALEERQANNARASVIAASLQRDADSKHAAYDRLSQLALESRQA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQNSIAQAQIIEAAQTPRAPSWPNKPLLFMVSFLVGLAAGIAVITTQELMVSGLRTVEEVEEKLGVPLLAAIPNVRKNTR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PANLLIEKPTSQFAEALRNARASILGVREKDRPQIIALTSALPSEGKTTTSLGLARTMAISGDRTILVDADVRRAMLRNI
                                      TSALPSEGKTTTSLGLARTMAISGDRTILVDADVRRAMLRNI
                                             GKT                 ILVDADVR       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDTSSTGPGIVEVLHGEVDLDQAIQPSGVENLDQILVQKPYFSSENMFGSGQMQTMLDELSKRYDTIILDLPPLVGLADG
LDTSSTGPGIVEVLHGEVDLDQAIQPSGVENLDQILVQKPYFSSENMFGSGQMQTMLDELSKRYDTIILDLPPLVGLADG
                                                                  IILDLPP       
       650       660       670       680       690       700       710
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFIAALADAVVLVIKWDTTPADAVISAADHLKSDGANLVGAMFTMVDQSSKAAGAYYYYTKQYSSYYQTT
RFIAALADAVVLVIKWDTTPADAVISAADHLKSDGANLVGAMFTMVDQSSKAAGAYYYYTKQYSSYYQT 
                                                       YYYYTKQYSSYY   

© 1998-2019