BYKdb

Annotate results for A0A0Q4IZ35

A0A0Q4IZ35 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4IZ35
DOMAINtad28/202RPPIIQTYLRIALRWKYVIIGVTVACIVLGLIVTLLMTPKYTSTATVEIAREASQVTNIQ
AVERDTSVADQEFYQTQYGLLKSRALSERVATQLQLVDNPDFFKMFGTKDKNPAFDLTNN
RYTSAGRAERQRVAGEILLQNLSVDPTRLSRLVDIAFTSPQAAFSARVANAWAEN
DOMAINcd546/735TSTRPAEGKSTTALALATMLARANKRVIIVDGDMRSPSIHHFGNVGHERGLSNFLSGEEG
IEPLTFQMPDLGLTAMSAGPIPPNAAELLTGTRLTTLIDRLLEDYDHVVIDSPPVMGLAD
APLIAAQVEGVVYAVESHGIRATQVKTALRRLEAANVRIFGGVLTKFQARRAGYGNSYEY
GYGYGRAKDD
SITEWalker A553/555GKS
SITEWalker A'573/580IIVDGDMR
SITEWalker B653/659VVIDSPP
SITEY Cluster719/729YGNSYEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNVIMSDLQYGFAGNGTTMAPQSVESERPPIIQTYLRIALRWKYVIIGVTVACIVLGLIVTLLMTPKYTSTATVEIAREA
                           RPPIIQTYLRIALRWKYVIIGVTVACIVLGLIVTLLMTPKYTSTATVEIAREA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQVTNIQAVERDTSVADQEFYQTQYGLLKSRALSERVATQLQLVDNPDFFKMFGTKDKNPAFDLTNNRYTSAGRAERQRV
SQVTNIQAVERDTSVADQEFYQTQYGLLKSRALSERVATQLQLVDNPDFFKMFGTKDKNPAFDLTNNRYTSAGRAERQRV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGEILLQNLSVDPTRLSRLVDIAFTSPQAAFSARVANAWAENFIQTNLERKVQATSYGRNLLERQLRLQKQRLDESQRQL
AGEILLQNLSVDPTRLSRLVDIAFTSPQAAFSARVANAWAEN                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRYALQQKIINLPAQTGSTAGGPTAERSIVADDLAALNTALTQATADRIEAEARYRSGSAGGTSSEALGNVAINNLRQRR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELAAQYQQMMVQFEPGYPAAQALKSQIDQLDRAIGREESRVKGSIEGAYRAGAARESALQAKVDQLKLSYLDNRRRSIQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YNIFQQEVDTNRALYDGLLQRYKEIGIANGVGVNNISVVDTADEPQKPSSPRLFLNLLISLLGGLALGAVTAFALEQMDE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFGNPSEVERKLGLPLLGSVPKVDEDREPRDDLLDRKSDLVDAYLAISTNLGFTTEHGAPRSFSVTSTRPAEGKSTTALA
                                                                 TSTRPAEGKSTTALA
                                                                        GKS     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LATMLARANKRVIIVDGDMRSPSIHHFGNVGHERGLSNFLSGEEGIEPLTFQMPDLGLTAMSAGPIPPNAAELLTGTRLT
LATMLARANKRVIIVDGDMRSPSIHHFGNVGHERGLSNFLSGEEGIEPLTFQMPDLGLTAMSAGPIPPNAAELLTGTRLT
            IIVDGDMR                                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLIDRLLEDYDHVVIDSPPVMGLADAPLIAAQVEGVVYAVESHGIRATQVKTALRRLEAANVRIFGGVLTKFQARRAGYG
TLIDRLLEDYDHVVIDSPPVMGLADAPLIAAQVEGVVYAVESHGIRATQVKTALRRLEAANVRIFGGVLTKFQARRAGYG
            VVIDSPP                                                           YG
       730       740
....:....|....:....|
NSYEYGYGYGRAKDDAKGQG
NSYEYGYGYGRAKDD     
NSYEYGYGY           

© 1998-2019