BYKdb

Annotate results for A0A0Q4JA44

A0A0Q4JA44 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4JA44
DOMAINtad42/201RELSLALLWRVAVEWRWLILAATGTGIAGAVLITLLTPLLYRSTAALELNPPEVEIMADE
GSKGGRQSSMRGDANFVGTQLALLGSRALAERVAQNLNLAADPAIVGEVGDRTRNTASAA
DFVQSGTQVRLLPQSMIVNVSFVARDPQTAAKVVNGVADA
DOMAINcd541/726TSTRPAEGKSTSAWALAYSFTRLGKSVLLIDADMRRPAFVTGRDNIGLSHILTNTGSLKE
HVLHTDVDGLWIMPSGTIPPSPPELIASARFASLLADVAATFDVVVIDGPPILGLADSPL
LSSIAQATLMVIESGRTRTRAAIEAQNRLRTAGAHMVGAILTRYQPQASYGYGYGYGYGY
GQSKDQ
SITE-564/-566GKS
SITEWalker A'568/575LLIDADMR
SITEWalker B645/651VVIDGPP
SITEY Cluster704/729YQPQASYGYGYGYGYGYGQSKDQYRY
SITEWalker A548/550GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASPGAAGPTNLTVQPDQRRDLASMSQAGNYGGYGNGGAGGRELSLALLWRVAVEWRWLILAATGTGIAGAVLITLLTPL
                                         RELSLALLWRVAVEWRWLILAATGTGIAGAVLITLLTPL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LYRSTAALELNPPEVEIMADEGSKGGRQSSMRGDANFVGTQLALLGSRALAERVAQNLNLAADPAIVGEVGDRTRNTASA
LYRSTAALELNPPEVEIMADEGSKGGRQSSMRGDANFVGTQLALLGSRALAERVAQNLNLAADPAIVGEVGDRTRNTASA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADFVQSGTQVRLLPQSMIVNVSFVARDPQTAAKVVNGVADAYISTNLERRYQSSSYARDFLQKQIATTRRDLERSERQLT
ADFVQSGTQVRLLPQSMIVNVSFVARDPQTAAKVVNGVADA                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYAQAQRLISTGGSEEGGDTNSLTGSSLVALNSALAATQARRIAAEQRYREAALGGATTEGSVNAVPLRGQIAALDAEYQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKLQTFRPDYPEMVALKARIDALRKSVVSETRTANSDRLGTLRQEFQAARAEEDRLRSQVSGLSGSVLEQRGRLIQYNIL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRDVDTNRTLYDALLQRYKEIGVAGGIGTAVASVVDRGIVPGNAFSPSLYKNLMIGAVLGLIAGMLAAIALEFINDTIKT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDDVRDKLQLPFLGGIPNAKTAKPIEELRDTLSPVSEAYLSTASAMQFVTEGGAPKTLLVTSTRPAEGKSTSAWALAYSF
                                                            TSTRPAEGKSTSAWALAYSF
                                                                   GKS          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRLGKSVLLIDADMRRPAFVTGRDNIGLSHILTNTGSLKEHVLHTDVDGLWIMPSGTIPPSPPELIASARFASLLADVAA
TRLGKSVLLIDADMRRPAFVTGRDNIGLSHILTNTGSLKEHVLHTDVDGLWIMPSGTIPPSPPELIASARFASLLADVAA
       LLIDADMR                                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TFDVVVIDGPPILGLADSPLLSSIAQATLMVIESGRTRTRAAIEAQNRLRTAGAHMVGAILTRYQPQASYGYGYGYGYGY
TFDVVVIDGPPILGLADSPLLSSIAQATLMVIESGRTRTRAAIEAQNRLRTAGAHMVGAILTRYQPQASYGYGYGYGYGY
    VVIDGPP                                                    YQPQASYGYGYGYGYGY
       730       740        
....:....|....:....|....:...
GQSKDQYRYVAGGNEKKRRIMLTMHDET
GQSKDQ                      
GQSKDQYRY                   

© 1998-2019