BYKdb

Annotate results for A0A0Q4JGB5

A0A0Q4JGB5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4JGB5
DOMAINtad25/183PMDSIRHAFATVRHRKWLAIGVFAIILALVLAYGFTRTKLYTASAGMVVNSRELNVSEKD
KEVLPGLSTAETAVATEVEIMRSSAVALGTVRALNLVANPVFAASISKLPGADREAAATG
LVIGGTKILRPGESSVVSIAYTAPDPMLAKAVADQIGHQ
DOMAINcd528/716TSARPSEGKTTLAISLARTSAMAGSRTLLVDADLRRASVSRVMGLPPHAGMVQVLRRTAT
LDEALIHDPVSGMYVLPAGDTTENRQDLFAAANIGALLAEAEKRFDLVIFDAAPALAVTD
ARLLLRQVDEVLMALRWNDTPSQSAAATLKRMRALDIEPLGVIATRVDMRQLAVFGHGDV
DRDHADYGA
SITEWalker A535/537GKT
SITEWalker A'555/562LLVDADLR
SITEWalker B635/641VIFDAAP
SITEY Cluster714/718YGAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDDFRSSQTAEPRSKGRLAATIGDPMDSIRHAFATVRHRKWLAIGVFAIILALVLAYGFTRTKLYTASAGMVVNSRELNV
                        PMDSIRHAFATVRHRKWLAIGVFAIILALVLAYGFTRTKLYTASAGMVVNSRELNV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEKDKEVLPGLSTAETAVATEVEIMRSSAVALGTVRALNLVANPVFAASISKLPGADREAAATGLVIGGTKILRPGESSV
SEKDKEVLPGLSTAETAVATEVEIMRSSAVALGTVRALNLVANPVFAASISKLPGADREAAATGLVIGGTKILRPGESSV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSIAYTAPDPMLAKAVADQIGHQYLAVKEKSRRAAVEQVGRGLGTELDNLRVQLEATDTEVARYRTQHDLFDSQGATFTQ
VSIAYTAPDPMLAKAVADQIGHQ                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QELSLYKQQQAAAQAALADAQAKLSTARGQTRKGDTGGVGAVLQSPVIQQLRNQRALLATTYADLQGRYQPDHPDLIRTK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQVEALDSAIGAETSRQLANLNANAQIARDQVANAAGIVARTTGTLASDNTASVQLSQLQRKADGLRATYQALLERKNLI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSQALVADEDARIFSPAALPQRPTSPNKPLILMIGLVLATIVAGAAVWIAEAFDRKLSSSADIERKLGLPHIANIPEIAS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IARPGEEGISPIDFPVERPLSLYAEQLRAVRLALVRKGRSGMTSVGITSARPSEGKTTLAISLARTSAMAGSRTLLVDAD
                                               TSARPSEGKTTLAISLARTSAMAGSRTLLVDAD
                                                      GKT                 LLVDAD
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRRASVSRVMGLPPHAGMVQVLRRTATLDEALIHDPVSGMYVLPAGDTTENRQDLFAAANIGALLAEAEKRFDLVIFDAA
LRRASVSRVMGLPPHAGMVQVLRRTATLDEALIHDPVSGMYVLPAGDTTENRQDLFAAANIGALLAEAEKRFDLVIFDAA
LR                                                                        VIFDAA
       650       660       670       680       690       700       710         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
PALAVTDARLLLRQVDEVLMALRWNDTPSQSAAATLKRMRALDIEPLGVIATRVDMRQLAVFGHGDVDRDHADYGAYYA
PALAVTDARLLLRQVDEVLMALRWNDTPSQSAAATLKRMRALDIEPLGVIATRVDMRQLAVFGHGDVDRDHADYGA   
P                                                                        YGAYY 

© 1998-2019