BYKdb

Annotate results for A0A0Q4KY77

A0A0Q4KY77 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4KY77
DOMAINtad26/201SNFSLSHLLAILKKRKWLIIGSVVGALLLGIVITLLMTPQYTSVSVVEIQRETRNFTNVD
GVDSRSPSAVDSEFYETQAGLLRSVALAGSVVTDSRLQDSAAFFTMFKSSKAKNWFDNGK
LVPRASTRDERVREASEILLDHIKILIQRQSRLATISFTSPEVGFSKKIVDSWAAH
DOMAINcd542/731TSSRPNEGKSLTSFGLAKTLAVQGRRVLLIDADMRSPSVHYMLDLEATPGLSSLLTNAAS
IQDTVQQTSIANLSVIAAGPTPPSAAELLSGGRFKDMVVALLETFDHIVIDAPPVMGFAD
SPLIASQVEGVCFVIEAHGTNKSSARTAISRLRGADTTIFGAIVTKFNSKRAFSGYGYDY
GYGYGYGESA
SITEWalker A549/551GKS
SITEWalker A'569/576LLIDADMR
SITEWalker B649/655IVIDAPP
SITEY Cluster717/727YGYDYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQYERTPDAMRDLDGPLIDVGGGGKSNFSLSHLLAILKKRKWLIIGSVVGALLLGIVITLLMTPQYTSVSVVEIQRETRN
                         SNFSLSHLLAILKKRKWLIIGSVVGALLLGIVITLLMTPQYTSVSVVEIQRETRN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FTNVDGVDSRSPSAVDSEFYETQAGLLRSVALAGSVVTDSRLQDSAAFFTMFKSSKAKNWFDNGKLVPRASTRDERVREA
FTNVDGVDSRSPSAVDSEFYETQAGLLRSVALAGSVVTDSRLQDSAAFFTMFKSSKAKNWFDNGKLVPRASTRDERVREA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEILLDHIKILIQRQSRLATISFTSPEVGFSKKIVDSWAAHFVQATLDRRYAATAYARKFLEDRLSQLRIRIDQAERQLV
SEILLDHIKILIQRQSRLATISFTSPEVGFSKKIVDSWAAH                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYAARQDIVNLPSEVASTPGSGAAPERSLVAENLVALNKELATATGERIEAQSRLGAKGGDVQEALSNSGISQMRAKRAD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSSEYAEMIQKFDPAYPPAQALRAQITTLDQSIGREEGRVRSTLQETYNAAQERETALASKVDGLKSSLFDLRRRSTQYN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILMRDVDTNRQLYDALLQRYKEIGVAGGVGANNIAVVDAGDLPDKPSSPKLLLNLAFALIGGLIVGASLAFALEQLEDSL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDPAEVAELLRVPLIGVVPQVSEEPLAALLDVKSPLSEAYFSVQTSLALATMNGFPRSLVITSSRPNEGKSLTSFGLAKT
                                                             TSSRPNEGKSLTSFGLAKT
                                                                    GKS         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVQGRRVLLIDADMRSPSVHYMLDLEATPGLSSLLTNAASIQDTVQQTSIANLSVIAAGPTPPSAAELLSGGRFKDMVV
LAVQGRRVLLIDADMRSPSVHYMLDLEATPGLSSLLTNAASIQDTVQQTSIANLSVIAAGPTPPSAAELLSGGRFKDMVV
        LLIDADMR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLETFDHIVIDAPPVMGFADSPLIASQVEGVCFVIEAHGTNKSSARTAISRLRGADTTIFGAIVTKFNSKRAFSGYGYD
ALLETFDHIVIDAPPVMGFADSPLIASQVEGVCFVIEAHGTNKSSARTAISRLRGADTTIFGAIVTKFNSKRAFSGYGYD
        IVIDAPP                                                             YGYD
       730      
....:....|....:.
YGYGYGYGESATKAKR
YGYGYGYGESA     
YGYGYGY         

© 1998-2019