BYKdb

Annotate results for A0A0Q4LKJ5

A0A0Q4LKJ5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4LKJ5
DOMAINtad1/137MELRAFVAVVRSSWQLIVVLAIGAVLVGAVASLLTTKTYSSRTQLFVSVSSLGASDAGDL
VQGSSAAQAKVRSYVDVVTSGRVLQPVIDEWQLDTTPAQLAARVEASSPVNTSLITIRVT
DTDPARSARLAGAVAAS
DOMAINcd270/458TSAMPSEGKSTTAANLAVCLSETGASVLLVDADLRRPRVAEVMGLEGAAGLTDLLVGRAE
LDDVVQPWGFLGLRVLPSGSVPPNPSELLGSMAMVSLLTEIEAAYDFVVIDSPPLLPVTD
AAVLSRCVSGVVVVAAARRSTRHQLRQALTSISEIGSRTLGVVLTMVPARGAGAYGYGSY
TGYFTTQSA
SITEWalker A277/279GKS
SITEWalker A'297/304LLVDADLR
SITEWalker B377/383VVIDSPP
SITEY Cluster444/452YGYGSYTGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRAFVAVVRSSWQLIVVLAIGAVLVGAVASLLTTKTYSSRTQLFVSVSSLGASDAGDLVQGSSAAQAKVRSYVDVVTS
MELRAFVAVVRSSWQLIVVLAIGAVLVGAVASLLTTKTYSSRTQLFVSVSSLGASDAGDLVQGSSAAQAKVRSYVDVVTS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRVLQPVIDEWQLDTTPAQLAARVEASSPVNTSLITIRVTDTDPARSARLAGAVAASFETVVEDELERPEGGGSSLVTVE
GRVLQPVIDEWQLDTTPAQLAARVEASSPVNTSLITIRVTDTDPARSARLAGAVAAS                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLDEPVVPTTPTNPRPVLWIGLAAAVGLLGGVVLALLRSTLDTRIRGKGDVEALGDTPVIGAVGFHADASTTPLIVHDEP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSPLAESFRALRTNLQFLAFEGSRRSFVVTSAMPSEGKSTTAANLAVCLSETGASVLLVDADLRRPRVAEVMGLEGAAGL
                             TSAMPSEGKSTTAANLAVCLSETGASVLLVDADLRRPRVAEVMGLEGAAGL
                                    GKS                 LLVDADLR                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDLLVGRAELDDVVQPWGFLGLRVLPSGSVPPNPSELLGSMAMVSLLTEIEAAYDFVVIDSPPLLPVTDAAVLSRCVSGV
TDLLVGRAELDDVVQPWGFLGLRVLPSGSVPPNPSELLGSMAMVSLLTEIEAAYDFVVIDSPPLLPVTDAAVLSRCVSGV
                                                        VVIDSPP                 
       410       420       430       440       450       460       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
VVVAAARRSTRHQLRQALTSISEIGSRTLGVVLTMVPARGAGAYGYGSYTGYFTTQSATPGPEERRR
VVVAAARRSTRHQLRQALTSISEIGSRTLGVVLTMVPARGAGAYGYGSYTGYFTTQSA         
                                           YGYGSYTGY               
© 1998-2019