BYKdb

Annotate results for A0A0Q4M3J4

A0A0Q4M3J4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4M3J4
DOMAINtad1/137MDLRDYARLARRSWWIVLIASAVGAGIALAISSVVTPRYVSTAQLYVVVRASGDATTGDV
VQGSTAAQQKVLSYVDIASSSRVLGPVIDELGLDVSSRELAESVTATSPEDTALVVIEAA
DPSAEQSARIADAIATT
DOMAINcd267/456TSPSQGEGKTTVACNLAIALADSGARVVLVDADVRRPQVADRMGLEGAAGLTDVLIGRAE
VDDVLQPWGRDRLMVLPAGAIPPNPSELLGSQGMSTLLTDLAHEFDHVVIDAAPILPVTD
AAVVSTVADGALMVIAASRTQISDATAARAALDRVGGRVVGVVLSMVPTKGADAYAANNS
YYRAESRHET
SITEWalker A274/276GKT
SITEWalker A'294/301VLVDADVR
SITEWalker B374/380VVIDAAP
SITEY Cluster441/448YAANNSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLRDYARLARRSWWIVLIASAVGAGIALAISSVVTPRYVSTAQLYVVVRASGDATTGDVVQGSTAAQQKVLSYVDIASS
MDLRDYARLARRSWWIVLIASAVGAGIALAISSVVTPRYVSTAQLYVVVRASGDATTGDVVQGSTAAQQKVLSYVDIASS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRVLGPVIDELGLDVSSRELAESVTATSPEDTALVVIEAADPSAEQSARIADAIATTLSRVVDSIENVETAGVVRLELVQ
SRVLGPVIDELGLDVSSRELAESVTATSPEDTALVVIEAADPSAEQSARIADAIATT                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GADTPDSPESPRPVVNTALGALLGSVAGLGLAVLRSTLDTRIRTAAAAEAASGAPAMAAITYDPDIQRRPLIVHSDPHDH


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAEAFRTLRTNLRFASVGGHLTTLVITSPSQGEGKTTVACNLAIALADSGARVVLVDADVRRPQVADRMGLEGAAGLTDV
                          TSPSQGEGKTTVACNLAIALADSGARVVLVDADVRRPQVADRMGLEGAAGLTDV
                                 GKT                 VLVDADVR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIGRAEVDDVLQPWGRDRLMVLPAGAIPPNPSELLGSQGMSTLLTDLAHEFDHVVIDAAPILPVTDAAVVSTVADGALMV
LIGRAEVDDVLQPWGRDRLMVLPAGAIPPNPSELLGSQGMSTLLTDLAHEFDHVVIDAAPILPVTDAAVVSTVADGALMV
                                                     VVIDAAP                    
       410       420       430       440       450       460    
....:....|....:....|....:....|....:....|....:....|....:....|....
IAASRTQISDATAARAALDRVGGRVVGVVLSMVPTKGADAYAANNSYYRAESRHETGASSPSGR
IAASRTQISDATAARAALDRVGGRVVGVVLSMVPTKGADAYAANNSYYRAESRHET        
                                        YAANNSYY                
© 1998-2019