BYKdb

Annotate results for A0A0Q4M3V0

A0A0Q4M3V0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4M3V0
DOMAINtad15/251HEISPGRLIGELVDNRRLIICITTTITLLTLVYILFATPVYQADAVIQVEQKEGNAILES
LNQMLPDSTPQSAPEISLLQSRMILGKTVSDLNLQTVVQQLYFPIFGRGWARMMGHAPGQ
LAISRLYLPADGSSAPKVILSIIDANHYLISGKTFKTKGRVGELVEDSNISIKVDKIDAN
PGDEFSVKYISEFDAIDNLQNNYSVSEQGKDSGMLSLVLTGTDNLLLKRILDDITSN
DOMAINcd536/723SGASPGVGKTFISSNLAEVISQIGRKVLLIDADMRRGNLHAIFAQDVGLGLSEILTGKAE
IDEAVKIARGSNFDYISRGRIPSNPAEILMSRRLEDLLSWASKHYDYVIIDTPPILAVTE
AAIIGQYVDTTLLVARFEENTAKQIEVCINRLAQTGVKVTGCILNGLEKKQGSYYTYGYD
NYGIAYSS
SITEWalker A543/545GKT
SITEWalker A'563/570LLIDADMR
SITEWalker B643/649VIIDTPP
SITE-640/-642YDY
SITEY Cluster709/721YYTYGYDNYGIAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSPAPSQKKIVSSSHEISPGRLIGELVDNRRLIICITTTITLLTLVYILFATPVYQADAVIQVEQKEGNAILESLNQMLP
              HEISPGRLIGELVDNRRLIICITTTITLLTLVYILFATPVYQADAVIQVEQKEGNAILESLNQMLP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSTPQSAPEISLLQSRMILGKTVSDLNLQTVVQQLYFPIFGRGWARMMGHAPGQLAISRLYLPADGSSAPKVILSIIDAN
DSTPQSAPEISLLQSRMILGKTVSDLNLQTVVQQLYFPIFGRGWARMMGHAPGQLAISRLYLPADGSSAPKVILSIIDAN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HYLISGKTFKTKGRVGELVEDSNISIKVDKIDANPGDEFSVKYISEFDAIDNLQNNYSVSEQGKDSGMLSLVLTGTDNLL
HYLISGKTFKTKGRVGELVEDSNISIKVDKIDANPGDEFSVKYISEFDAIDNLQNNYSVSEQGKDSGMLSLVLTGTDNLL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKRILDDITSNYLAQNIDRQAAHDAKSLDFLKVQLPKVRSDLDTAEDKLNQYRQQKDTIDLPMEAKTVLDQIVNVENQLN
LKRILDDITSN                                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELTFREAEISQLYTKDHPTYKALLEKKQTLKEEKERLNSKVSTMPDTQQQVLRLSRDVESGRTVYMQLLNRQQELDIAKS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIGNVRIIDIPLTRPKPVKPKKILLLAMAVVFGGMFAVGFVFIRLMLHKGINSSESLEEHGINVYANIPISEWHLSRLR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSSKYNDVKKTNISKATRGLLALENPADLAIEAIRNLRTSLHFAMIETDNNLIMISGASPGVGKTFISSNLAEVISQIGR
                                                       SGASPGVGKTFISSNLAEVISQIGR
                                                              GKT               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVLLIDADMRRGNLHAIFAQDVGLGLSEILTGKAEIDEAVKIARGSNFDYISRGRIPSNPAEILMSRRLEDLLSWASKHY
KVLLIDADMRRGNLHAIFAQDVGLGLSEILTGKAEIDEAVKIARGSNFDYISRGRIPSNPAEILMSRRLEDLLSWASKHY
  LLIDADMR                                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYVIIDTPPILAVTEAAIIGQYVDTTLLVARFEENTAKQIEVCINRLAQTGVKVTGCILNGLEKKQGSYYTYGYDNYGIA
DYVIIDTPPILAVTEAAIIGQYVDTTLLVARFEENTAKQIEVCINRLAQTGVKVTGCILNGLEKKQGSYYTYGYDNYGIA
  VIIDTPP                                                           YYTYGYDNYGIA
       
....:..
YSSQKEA
YSS    
Y      

© 1998-2019