BYKdb

Annotate results for A0A0Q4NLV8

A0A0Q4NLV8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4NLV8
DOMAINtad16/251YLVDVRYLWGVLLDSKVLIVVLTAAGVVLALMWGIISPPVFQAEALIQLEKEGTENIFSK
LYGLQPDDTSSASTEIVLIKSRSVLGKSVEDMGLDIEIEQEKFLNLAKAGARLLGQKNVQ
VTVPVFNVPEERLDQPFSLTILDEGRFSLAGDNVAMHGRFGEALNAEGMTIVVSQSDASP
GTRFTLTKINPFKAIKNLEKNLNVVESSKDTGMLRLSLLGEDPKTIRRILSSISDN
DOMAINcd522/710AGATSHIGKSFISSNLAVVFAQSDLRVLLVDADMRRGYLHNIFNVGYAPGLSELLSSGLA
FGQAIHHTRVSNLDVMTRGTAPSNPSELLLTPRFPAFCQWASEHYDVVIFDTPPVMAVGD
AMIIANYSGVNLMVARFEVTTPDELDISLTQFAQEGYEVNGVVLNATHRRAAQFFRHGHY
ENYQYAMNK
SITEWalker A529/531GKS
SITEWalker A'549/556LLVDADMR
SITEWalker B629/635VIFDTPP
SITEY Cluster701/706YENYQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKLQGVVKPIRGEDYLVDVRYLWGVLLDSKVLIVVLTAAGVVLALMWGIISPPVFQAEALIQLEKEGTENIFSKLYGLQ
               YLVDVRYLWGVLLDSKVLIVVLTAAGVVLALMWGIISPPVFQAEALIQLEKEGTENIFSKLYGLQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDDTSSASTEIVLIKSRSVLGKSVEDMGLDIEIEQEKFLNLAKAGARLLGQKNVQVTVPVFNVPEERLDQPFSLTILDEG
PDDTSSASTEIVLIKSRSVLGKSVEDMGLDIEIEQEKFLNLAKAGARLLGQKNVQVTVPVFNVPEERLDQPFSLTILDEG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFSLAGDNVAMHGRFGEALNAEGMTIVVSQSDASPGTRFTLTKINPFKAIKNLEKNLNVVESSKDTGMLRLSLLGEDPKT
RFSLAGDNVAMHGRFGEALNAEGMTIVVSQSDASPGTRFTLTKINPFKAIKNLEKNLNVVESSKDTGMLRLSLLGEDPKT

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRRILSSISDNYVHKSIDKKSESARKSLTFVQHQLPLIKAQLEKAESRLNLFRKERGSIDLPMEARTILDSGVGIDSQLS
IRRILSSISDN                                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALKVEQSDLSKRYTPAHPAFRALLEKKQALEKAKAALGNKISAMPETQQNVFRLTRDVQSAQDIYMLLLNKQQELNIDTV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STVGNVHIVDAAEVLPQPIYPKNRQLALTGAVLGLVLSIALVFIRNVFRRGISGSDQLRQMGFSVFSSIPYSKKQQGERS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVSEPLLAISAPDDSAIEAIRSLRTSLYFQLKQAENKILMLAGATSHIGKSFISSNLAVVFAQSDLRVLLVDADMRRGYL
                                         AGATSHIGKSFISSNLAVVFAQSDLRVLLVDADMRRGYL
                                                GKS                 LLVDADMR    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HNIFNVGYAPGLSELLSSGLAFGQAIHHTRVSNLDVMTRGTAPSNPSELLLTPRFPAFCQWASEHYDVVIFDTPPVMAVG
HNIFNVGYAPGLSELLSSGLAFGQAIHHTRVSNLDVMTRGTAPSNPSELLLTPRFPAFCQWASEHYDVVIFDTPPVMAVG
                                                                    VIFDTPP     
       650       660       670       680       690       700       710  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
DAMIIANYSGVNLMVARFEVTTPDELDISLTQFAQEGYEVNGVVLNATHRRAAQFFRHGHYENYQYAMNKKS
DAMIIANYSGVNLMVARFEVTTPDELDISLTQFAQEGYEVNGVVLNATHRRAAQFFRHGHYENYQYAMNK  
                                                            YENYQY      

© 1998-2019