BYKdb

Annotate results for A0A0Q4QG39

A0A0Q4QG39 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q4QG39
DOMAINcd46/230ASSQPDEGKTTTITNLAVTIAQEERKVLLVDADMRKPSLHQVFDKPNRIGLSSAISNQFS
WQEAVMDTMVEHLSVITSGPIPPNPSEMLGSNRMKALVQEWKEHYDVILFDTPPVLAVTD
ALIVSAFCDGVVLVVLAGKVKKEMVKKMKANLDRVQAQIVGVVMNKINPKDSEDIQLQYY
ETAKS
SITEWalker A53/55GKT
SITEWalker A'73/80LLVDADMR
SITEWalker B153/159ILFDTPP
SITEY Cluster224/225YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRLTSETNLVALTNPNSPISEVYRTLRTNIQYAEIDTPKQILMIASSQPDEGKTTTITNLAVTIAQEERKVLLVDADMR
                                             ASSQPDEGKTTTITNLAVTIAQEERKVLLVDADMR
                                                    GKT                 LLVDADMR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPSLHQVFDKPNRIGLSSAISNQFSWQEAVMDTMVEHLSVITSGPIPPNPSEMLGSNRMKALVQEWKEHYDVILFDTPPV
KPSLHQVFDKPNRIGLSSAISNQFSWQEAVMDTMVEHLSVITSGPIPPNPSEMLGSNRMKALVQEWKEHYDVILFDTPPV
                                                                        ILFDTPP 
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVTDALIVSAFCDGVVLVVLAGKVKKEMVKKMKANLDRVQAQIVGVVMNKINPKDSEDIQLQYYETAKS
LAVTDALIVSAFCDGVVLVVLAGKVKKEMVKKMKANLDRVQAQIVGVVMNKINPKDSEDIQLQYYETAKS
                                                               YY     
© 1998-2019