BYKdb

Annotate results for A0A0Q4UFQ5

A0A0Q4UFQ5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q4UFQ5
DOMAINcd401/592TSARAAEGKSSTSYAIARSIARTNRSVLLIDADMRSPSVHALLEKPLDQGLSNFLAGAND
IDRLIRPTEIAGLSIISAGPQPPSTPELLSGDRLRALLEQMGDRFDHIVLDLPPVMGLAD
APLIASQVEGTLVITAAHSTHKNVARIAIGRLRSAHAHMLGVVLTMFDAKQASYGYGYGY
GYGNGYGYGSSS
SITEWalker A408/410GKS
SITEWalker A'428/435LLIDADMR
SITEWalker B508/514IVLDLPP
SITEY Cluster574/588YGYGYGYGYGNGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFESGRPIQTAAARASRIKAAGNLILARMDVEPERMSRLVEISFTSPDPELSKRVVDAWSTNFIQSTLERRYSATSYARN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FLEERLKQLRIRIDESERALVNYASQQNIVNIPGSTDSNGQTTGERSLVVDDLANLNRELAQATAERVAAESRLNSGGAT


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEQLDNTANSTLRTKRAELAADYARMLQQFDPAYPPAKALQAQIRSIDAALRGEGSRVDAVLRATYQASLSREQQLTSQV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKLTGRVLDFRRRSIQYNILQREVDTNRQLYDALLQRYKEIGVAGGVGVNNIAVVDDAELPVAPDRPRPLFNMALALFAG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVVGAALAIVFEQIDEGLTDPIEVEEVLGLPLIGVTPKLPNDKPVVALDDPKSILTEAYASIVANLGFATSHGIPRTLAI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSARAAEGKSSTSYAIARSIARTNRSVLLIDADMRSPSVHALLEKPLDQGLSNFLAGANDIDRLIRPTEIAGLSIISAGP
TSARAAEGKSSTSYAIARSIARTNRSVLLIDADMRSPSVHALLEKPLDQGLSNFLAGANDIDRLIRPTEIAGLSIISAGP
       GKS                 LLIDADMR                                             
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPPSTPELLSGDRLRALLEQMGDRFDHIVLDLPPVMGLADAPLIASQVEGTLVITAAHSTHKNVARIAIGRLRSAHAHML
QPPSTPELLSGDRLRALLEQMGDRFDHIVLDLPPVMGLADAPLIASQVEGTLVITAAHSTHKNVARIAIGRLRSAHAHML
                           IVLDLPP                                              
       570       580       590       
....:....|....:....|....:....|....:..
GVVLTMFDAKQASYGYGYGYGYGNGYGYGSSSDEAAN
GVVLTMFDAKQASYGYGYGYGYGNGYGYGSSS     
             YGYGYGYGYGNGYGY         
© 1998-2019