BYKdb

Annotate results for A0A0Q4UQV7

A0A0Q4UQV7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4UQV7
DOMAINtad1/135MELRDYITVLRKGWVLILVLALVGVAAAAGYSIVKQPEYAASAQVFVSTETSGSAADLAQ
GNTFTQQRVLTYSNLVTTPIVLLPVISSLKLDMTAGELATLVSADAPLNTTLITINVTDT
DPVQAADIANATSQS
DOMAINcd268/457TSSVESEGKSTTVANLAIALDSAGYKVILIDADLRRPKIATYMNIEGAVGLTDVLIGRAV
IEDAAQPWGRGTMRVLPAGKIPPNPSELLGSRTMQLLIEQLETEYDFVLFDAPPLLPVTD
GAILAKKASGALVVVAAGKTHRNQLAGAVSALENIGAPVAGFVLTMMPTKGPGAYGYGRY
GYAYGYGLDE
SITE-405/-407GKT
SITEWalker A'295/302ILIDADLR
SITEWalker B375/381VLFDAPP
SITEY Cluster442/453YGYGRYGYAYGY
SITEWalker A275/277GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYITVLRKGWVLILVLALVGVAAAAGYSIVKQPEYAASAQVFVSTETSGSAADLAQGNTFTQQRVLTYSNLVTTPI
MELRDYITVLRKGWVLILVLALVGVAAAAGYSIVKQPEYAASAQVFVSTETSGSAADLAQGNTFTQQRVLTYSNLVTTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVISSLKLDMTAGELATLVSADAPLNTTLITINVTDTDPVQAADIANATSQSLTNVVQNIESTSENGGSTVKLTRVQ
VLLPVISSLKLDMTAGELATLVSADAPLNTTLITINVTDTDPVQAADIANATSQS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAQVPSAPVSPNVPVNVILGLLVGLALGVGIAVLRETLDNRVRTEQDVERISDAPIVGGIAFDSKASVRPLIVQADPRSP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAESFRTLRTNLQFLDLEASSARTFVMTSSVESEGKSTTVANLAIALDSAGYKVILIDADLRRPKIATYMNIEGAVGLTD
                           TSSVESEGKSTTVANLAIALDSAGYKVILIDADLRRPKIATYMNIEGAVGLTD
                                  GKS                 ILIDADLR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIGRAVIEDAAQPWGRGTMRVLPAGKIPPNPSELLGSRTMQLLIEQLETEYDFVLFDAPPLLPVTDGAILAKKASGALV
VLIGRAVIEDAAQPWGRGTMRVLPAGKIPPNPSELLGSRTMQLLIEQLETEYDFVLFDAPPLLPVTDGAILAKKASGALV
                                                      VLFDAPP                   
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVAAGKTHRNQLAGAVSALENIGAPVAGFVLTMMPTKGPGAYGYGRYGYAYGYGLDENNDENEVETPKKPSGFGPMRRAT
VVAAGKTHRNQLAGAVSALENIGAPVAGFVLTMMPTKGPGAYGYGRYGYAYGYGLDE                       
                                         YGYGRYGYAYGY                           
 
.
R


© 1998-2019