BYKdb

Annotate results for A0A0Q4URF3

A0A0Q4URF3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q4URF3
DOMAINtad13/171KIIDFGAVLNAVRRRLIPILITMIIVLGLTALSYKMVTPRYSAEGQVGIQRTNEEIVNAQ
EDQRVQPLTTDSSSVDTEVAQILSPETLGRVVDRLGLAKNPNFVGTDPLSPADARNAAIR
AIAGGLTATRDGTSYAINVNYLSTDPVMAAKIVNTTIDE
DOMAINcd516/705SSALPAEGKTSTSFSLARSSALAGLSTVLVDCDLRRQATSRQMEGAIQYGLADLLRGEAT
LDQVLVRDSASGAFLLPQRPSTAENDYDLIASSAMQQLVDQLRERFDLVILDTAPLLAIA
DSRAIASMADVALVAVRWRKTPAPAVRLALDHLAMAEARIGGIIMTMVDLKAQSRAGAGD
ELRYYKKYSS
SITEWalker A523/525GKT
SITEWalker A'543/550VLVDCDLR
SITEWalker B624/630VILDTAP
SITEY Cluster699/707YYKKYSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNPLVPVDQDSAKIIDFGAVLNAVRRRLIPILITMIIVLGLTALSYKMVTPRYSAEGQVGIQRTNEEIVNAQEDQRVQPL
            KIIDFGAVLNAVRRRLIPILITMIIVLGLTALSYKMVTPRYSAEGQVGIQRTNEEIVNAQEDQRVQPL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTDSSSVDTEVAQILSPETLGRVVDRLGLAKNPNFVGTDPLSPADARNAAIRAIAGGLTATRDGTSYAINVNYLSTDPVM
TTDSSSVDTEVAQILSPETLGRVVDRLGLAKNPNFVGTDPLSPADARNAAIRAIAGGLTATRDGTSYAINVNYLSTDPVM

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAKIVNTTIDEYLTRQQVEKRDERNKEIALLASRINEARGQLQGAETEVARFRAATNLVDIQNQSTNAQQSIAVLNQQLA
AAKIVNTTIDE                                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQAQQAVAEARNTARSASSAGAGSAVVSPVLQQLRTEEATLSAQQASLSERYGDRHPQVLETNQRLQETRRQIAAETAR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRQSLSAEADVARRRTSSIVSSLDAQKGQLLQGNAASVRLAELERKATTLKSLYEALLERYQQAIARQGTERSAGYVIAR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVAPTAPVSPKKVVFAGGGLLAALLAAAMVAAGLELAENGFSTRRQVERALGLPVLASVPDLRTLKRDRIKSPTPATISQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HLIDHPGSVYSESYRSIRTALKVGREEQAARVVAISSALPAEGKTSTSFSLARSSALAGLSTVLVDCDLRRQATSRQMEG
                                   SSALPAEGKTSTSFSLARSSALAGLSTVLVDCDLRRQATSRQMEG
                                          GKT                 VLVDCDLR          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIQYGLADLLRGEATLDQVLVRDSASGAFLLPQRPSTAENDYDLIASSAMQQLVDQLRERFDLVILDTAPLLAIADSRAI
AIQYGLADLLRGEATLDQVLVRDSASGAFLLPQRPSTAENDYDLIASSAMQQLVDQLRERFDLVILDTAPLLAIADSRAI
                                                               VILDTAP          
       650       660       670       680       690       700        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
ASMADVALVAVRWRKTPAPAVRLALDHLAMAEARIGGIIMTMVDLKAQSRAGAGDELRYYKKYSSYYS
ASMADVALVAVRWRKTPAPAVRLALDHLAMAEARIGGIIMTMVDLKAQSRAGAGDELRYYKKYSS   
                                                          YYKKYSSYY 

© 1998-2019