BYKdb

Annotate results for A0A0Q5ASZ3

A0A0Q5ASZ3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5ASZ3
DOMAINtad1/140MELRDVLRLLRDHWLAIVAAILLGTLLAFGWSLTQKPRYVADSQGIVSVDVGSGDPSQAV
YLRQISATVANSSLKTYLPLATSRDTAEIAIENLGLDVSPSALISAITVESETDAPVMNI
TASASTAEGAQKLADAWVAA
DOMAINcd280/469TSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDLLIGKAE
LQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTD
GAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYY
YTSYYGSERS
SITE-417/-419GKT
SITEWalker A'307/314VVVDGDLR
SITEWalker B387/393VIVDAPP
SITEY Cluster456/464YGYYYTSYY
SITEWalker A287/289GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDVLRLLRDHWLAIVAAILLGTLLAFGWSLTQKPRYVADSQGIVSVDVGSGDPSQAVYLRQISATVANSSLKTYLPL
MELRDVLRLLRDHWLAIVAAILLGTLLAFGWSLTQKPRYVADSQGIVSVDVGSGDPSQAVYLRQISATVANSSLKTYLPL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATSRDTAEIAIENLGLDVSPSALISAITVESETDAPVMNITASASTAEGAQKLADAWVAAVATRIQQINAETGAGDTVSL
ATSRDTAEIAIENLGLDVSPSALISAITVESETDAPVMNITASASTAEGAQKLADAWVAA                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVVQAAALPSSPAYPNLRLVLAIGALAGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIVPEA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTTDYVKSDGKHALAEALRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAK
                                       TSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAK
                                              GKS                 VVVDGDLR      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTDG
SFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTDG
                                                                  VIVDAPP       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSERSGARAETVPEPA
AILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSERS           
                                                       YGYYYTSYY                
    
....
PSAV


© 1998-2019