BYKdb

Annotate results for A0A0Q5AWK6

A0A0Q5AWK6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q5AWK6
DOMAINcd265/454TSANQAEGKSTIASGLARVTADSGQRTLLIDADLRRPTVAKMLGIDGAVGLSEVLSHQIP
VEDAIRPTGTEGLFALPSGHIPPNPSEMLGSAAMRTLVERLSKDYFVIIDAPPILPVTDA
SIVATVVDGVVFVVASNRTRRPEVTAARRILAQVRGRVLGTVLNMVTAQDGDTGYYYYDR
KNSYYTQPQQ
SITEWalker A272/274GKS
SITEWalker A'292/299LLIDADLR
SITEWalker B371/377VIIDAPP
SITEY Cluster439/449YYYYDRKNSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTVVDFIAFIRRNWKALVVAVLVGVTAMAAFSFVTPKVYESSSAGFVIAATDGSSADAISGAQTAVTRANAYLPLISSSA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYERIQSDPEANPGGEALNGRLTASVAPGSTLIQVTAEASTPENAAALANGALAALAAVIADIETQSTADRTPQITVVPL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENAEPASTPTSPNWLRNLLLGAAGGLVLGFVVAFLRRALDIRVRTVDQLTELFGVGVLGRIPKAGRRAGRKGETVDRITA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAYRALRTGLRFSSVDDETRSVVITSANQAEGKSTIASGLARVTADSGQRTLLIDADLRRPTVAKMLGIDGAVGLSEVLS
                        TSANQAEGKSTIASGLARVTADSGQRTLLIDADLRRPTVAKMLGIDGAVGLSEVLS
                               GKS                 LLIDADLR                     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HQIPVEDAIRPTGTEGLFALPSGHIPPNPSEMLGSAAMRTLVERLSKDYFVIIDAPPILPVTDASIVATVVDGVVFVVAS
HQIPVEDAIRPTGTEGLFALPSGHIPPNPSEMLGSAAMRTLVERLSKDYFVIIDAPPILPVTDASIVATVVDGVVFVVAS
                                                  VIIDAPP                       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRTRRPEVTAARRILAQVRGRVLGTVLNMVTAQDGDTGYYYYDRKNSYYTQPQQAATENAAVGRSARRSPRTQALEPVES
NRTRRPEVTAARRILAQVRGRVLGTVLNMVTAQDGDTGYYYYDRKNSYYTQPQQ                          
                                      YYYYDRKNSYY                               
       490   
....:....|...
RAERPTASRRTLR


© 1998-2019