BYKdb

Annotate results for A0A0Q5BQW6

A0A0Q5BQW6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5BQW6
DOMAINtad1/127MPIVAAILLGTLVAFGWSLTQKPRYEADSKGLVTVAVPDSGDGSQDLYGEQIAEALAKSR
LTTYVPIASSRDVAEIAIENLGLDISPSALISAITVTPEAAAPVLNVTAEASTADGAQKL
ADAWVSA
DOMAINcd267/456TSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDLLIGKAE
LQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTD
GAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYY
YTSYYGSEKT
SITE-404/-406GKT
SITEWalker A'294/301VVVDGDLR
SITEWalker B374/380VIVDAPP
SITEY Cluster443/451YGYYYTSYY
SITEWalker A274/276GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPIVAAILLGTLVAFGWSLTQKPRYEADSKGLVTVAVPDSGDGSQDLYGEQIAEALAKSRLTTYVPIASSRDVAEIAIEN
MPIVAAILLGTLVAFGWSLTQKPRYEADSKGLVTVAVPDSGDGSQDLYGEQIAEALAKSRLTTYVPIASSRDVAEIAIEN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGLDISPSALISAITVTPEAAAPVLNVTAEASTADGAQKLADAWVSAVATRIQQINAETGTGDSVSLKVIQDAALPGSPA
LGLDISPSALISAITVTPEAAAPVLNVTAEASTADGAQKLADAWVSA                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FPNLRLVLAVGALAGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIIPEADTTDYVKADGKHA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAESLRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDL
                          TSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDL
                                 GKS                 VVVDGDLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTDGAILTARTDGALVV
LIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTDGAILTARTDGALVV
                                                     VIVDAPP                    
       410       420       430       440       450       460       470 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
ISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSEKTGARPESASEPTPSAV
ISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSEKT               
                                          YGYYYTSYY                    
© 1998-2019