BYKdb

Annotate results for A0A0Q5CBC0

A0A0Q5CBC0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5CBC0
DOMAINtad1/137MQLNDYIRIVRRRWATIVVVTLVAVSCAAAYTITATKTYVASTQLFVSVQAADASSAVEA
VQGTSAAQEKVRTYVGVIKSSTVLAPVIKKLHLTTTPAALADRVTATANSNTTLMDVAVT
DTDPQRAAEIANAVGAS
DOMAINcd269/457TSSVPSEGKTTTTANLAIAIAESGATVVLVDGDLRRPRIAEIMGLEGAVGLTDILIGRVE
LEDALQPWGRGSLTVLPAGSIPPNPSELLGSAGMHALIRELTAAYDYVLVDAPPTLPVTD
AALLSTVTSGALVVAAAGRTTKNQLRSALDNLERTGSHPAGVILTMLPAKGPNAYGYGSY
DAYYGIDGK
SITEWalker A276/278GKT
SITEWalker A'296/303VLVDGDLR
SITEWalker B376/382VLVDAPP
SITE-373/-375YDY
SITEY Cluster443/452YGYGSYDAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQLNDYIRIVRRRWATIVVVTLVAVSCAAAYTITATKTYVASTQLFVSVQAADASSAVEAVQGTSAAQEKVRTYVGVIKS
MQLNDYIRIVRRRWATIVVVTLVAVSCAAAYTITATKTYVASTQLFVSVQAADASSAVEAVQGTSAAQEKVRTYVGVIKS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STVLAPVIKKLHLTTTPAALADRVTATANSNTTLMDVAVTDTDPQRAAEIANAVGASFTTEVLDLESPLAGGSSLVKVRT
STVLAPVIKKLHLTTTPAALADRVTATANSNTTLMDVAVTDTDPQRAAEIANAVGAS                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEPAVVPGYPSSPRVLFTLALGGLIGLAAGFSVAVLRSALDTRIHGSSDVEGITTVPILGGISFDPSIKNRPLIVRADPR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPRAEAFRALRTNLQFVDIGATKRCFVTTSSVPSEGKTTTTANLAIAIAESGATVVLVDGDLRRPRIAEIMGLEGAVGLT
                            TSSVPSEGKTTTTANLAIAIAESGATVVLVDGDLRRPRIAEIMGLEGAVGLT
                                   GKT                 VLVDGDLR                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DILIGRVELEDALQPWGRGSLTVLPAGSIPPNPSELLGSAGMHALIRELTAAYDYVLVDAPPTLPVTDAALLSTVTSGAL
DILIGRVELEDALQPWGRGSLTVLPAGSIPPNPSELLGSAGMHALIRELTAAYDYVLVDAPPTLPVTDAALLSTVTSGAL
                                                       VLVDAPP                  
       410       420       430       440       450       460       470  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
VVAAAGRTTKNQLRSALDNLERTGSHPAGVILTMLPAKGPNAYGYGSYDAYYGIDGKDPSLETDALISGRHR
VVAAAGRTTKNQLRSALDNLERTGSHPAGVILTMLPAKGPNAYGYGSYDAYYGIDGK               
                                          YGYGSYDAYY                    
© 1998-2019