BYKdb

Annotate results for A0A0Q5E5W5

A0A0Q5E5W5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5E5W5
DOMAINtad1/133MDLKDYLRIFRHRWLLIVAITAGIAALAHGYTLVTKPVYQSTAQLFVAVKSGDSVGELNQ
GNTFAQSRVSSYVILATGSTVRTMVAERLDLDPATLVGAISAANPAQSVLINISALDSDP
VAAARIANTASEV
DOMAINcd272/463TSSIPGEGKTTTAANLALVLAEAGNSVLLVDADLRRPRQHELFGLEGSVGLTTVLTGRIS
LDEAAQSVNGAGRLAVLTSGELPPNPSELLGSAAMERALAEMERTFDVVVVDTPPLVNVS
DPTALSTLASGVLLVASADGRLHRDQLRQSLENLSFVQAKLLGVVLNRVEASRGGQSYSY
SYYDRIPEPGTT
SITEWalker A279/281GKT
SITEWalker A'299/306LLVDADLR
SITEWalker B380/386VVVDTPP
SITEY Cluster449/454YSYSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLKDYLRIFRHRWLLIVAITAGIAALAHGYTLVTKPVYQSTAQLFVAVKSGDSVGELNQGNTFAQSRVSSYVILATGST
MDLKDYLRIFRHRWLLIVAITAGIAALAHGYTLVTKPVYQSTAQLFVAVKSGDSVGELNQGNTFAQSRVSSYVILATGST

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRTMVAERLDLDPATLVGAISAANPAQSVLINISALDSDPVAAARIANTASEVLVDLVDDVESTDAASSTDAAGGPTPVG
VRTMVAERLDLDPATLVGAISAANPAQSVLINISALDSDPVAAARIANTASEV                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTIVEQASPPWSPVAPNPLQNLAVGVFIGLALGVGTALLIEVLDTRLRGRAAIEKLTDTSILGTFTAEPADTPQLILGST


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESYSRRAESFRQLRTHLQFASIDGGLRSVMVTSSIPGEGKTTTAANLALVLAEAGNSVLLVDADLRRPRQHELFGLEGSV
                               TSSIPGEGKTTTAANLALVLAEAGNSVLLVDADLRRPRQHELFGLEGSV
                                      GKT                 LLVDADLR              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLTTVLTGRISLDEAAQSVNGAGRLAVLTSGELPPNPSELLGSAAMERALAEMERTFDVVVVDTPPLVNVSDPTALSTLA
GLTTVLTGRISLDEAAQSVNGAGRLAVLTSGELPPNPSELLGSAAMERALAEMERTFDVVVVDTPPLVNVSDPTALSTLA
                                                           VVVDTPP              
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGVLLVASADGRLHRDQLRQSLENLSFVQAKLLGVVLNRVEASRGGQSYSYSYYDRIPEPGTTAPKRRTRRKTAPTDAPD
SGVLLVASADGRLHRDQLRQSLENLSFVQAKLLGVVLNRVEASRGGQSYSYSYYDRIPEPGTT                 
                                                YSYSYY                          
       490       500       510       520   
....:....|....:....|....:....|....:....|...
TRRPAAAPALRRTPEQQQAQRELPGVTPPVDSSSSRRSRRERV


© 1998-2019