BYKdb

Annotate results for A0A0Q5FA12

A0A0Q5FA12 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5FA12
DOMAINtad6/193SFLDVESVIAIARRQWKIVAISVAVAAVLGIVNILTAVPLFTANVSVLIDRGNGQLADQL
SSIGSAGGSLMEDESSILSQVEIFKSDTIASAVVDKLDLTNDAVFMADDRSAMVQLIGTL
RSLLNVSQWFVSASAVADDAAAKHFAAERKLAENLDVSRVGRTYVLNVQYTSPSPELSSR
IANTVGDI
DOMAINcd551/741VSSLPGEGKSMTSINFAQLLADQGNRTILIDCDLRNPGATRAIGSHAEAGLLEAVLENID
PRKLLLQDPKTGLAFLPTVIKHRVPHSSELLASPAMRNILTHLSHNTDYIILDLPPLGPV
VDARAMASRVDGFLFVVEWGKTARHLVRQLLRDEVEIRNKCLGVILNKVDQRKLKLYRSF
GSSEYYQSHYT
SITE-690/-692GKT
SITEWalker A'578/585ILIDCDLR
SITEWalker B660/666IILDLPP
SITEY Cluster735/744YYQSHYTKYY
SITEWalker A558/560GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHQQGSFLDVESVIAIARRQWKIVAISVAVAAVLGIVNILTAVPLFTANVSVLIDRGNGQLADQLSSIGSAGGSLMEDES
     SFLDVESVIAIARRQWKIVAISVAVAAVLGIVNILTAVPLFTANVSVLIDRGNGQLADQLSSIGSAGGSLMEDES

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SILSQVEIFKSDTIASAVVDKLDLTNDAVFMADDRSAMVQLIGTLRSLLNVSQWFVSASAVADDAAAKHFAAERKLAENL
SILSQVEIFKSDTIASAVVDKLDLTNDAVFMADDRSAMVQLIGTLRSLLNVSQWFVSASAVADDAAAKHFAAERKLAENL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVSRVGRTYVLNVQYTSPSPELSSRIANTVGDIYLVDKLNSKYEATRRASDWLQNRIAELRQKALDSDLAVQRFRTTNNL
DVSRVGRTYVLNVQYTSPSPELSSRIANTVGDI                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSAGSVLVSDQQLSELNSALIVAQSETSKAEARFQRIQQIIASGQTDAIVTDVLGSTISNELRQKYLDASKREAQISARL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPDHVQAVRMRSEMSEYQRLMFEELNRIAESYKSDLDVAKAREKSLSDNVSQATGISASANETKVQLRELEREAETYKNL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YQTFLQRYQEAVQQQSFPVTEARVITRASPPKSPSHPKKTLILALFIVMGGAVGTGLGAFREIRDRFFRTGDQIRDTLKL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFLGMTPMISGQRLPAFSGSKLPAGELFKTNSVSNYVVDNPLSSFAETLRSAKLSADFGMVGKECKIIGVVSSLPGEGKS
                                                                      VSSLPGEGKS
                                                                             GKS
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSINFAQLLADQGNRTILIDCDLRNPGATRAIGSHAEAGLLEAVLENIDPRKLLLQDPKTGLAFLPTVIKHRVPHSSEL
MTSINFAQLLADQGNRTILIDCDLRNPGATRAIGSHAEAGLLEAVLENIDPRKLLLQDPKTGLAFLPTVIKHRVPHSSEL
                 ILIDCDLR                                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LASPAMRNILTHLSHNTDYIILDLPPLGPVVDARAMASRVDGFLFVVEWGKTARHLVRQLLRDEVEIRNKCLGVILNKVD
LASPAMRNILTHLSHNTDYIILDLPPLGPVVDARAMASRVDGFLFVVEWGKTARHLVRQLLRDEVEIRNKCLGVILNKVD
                   IILDLPP                                                      
       730       740        
....:....|....:....|....:...
QRKLKLYRSFGSSEYYQSHYTKYYQDAA
QRKLKLYRSFGSSEYYQSHYT       
              YYQSHYTKYY    

© 1998-2019