BYKdb

Annotate results for A0A0Q5H012

A0A0Q5H012 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5H012
DOMAINtad18/200EFLNVERILAMVRRQIGIVIAAVVVGIAVGLVFLITAVPTYTASTDILIDKGQSKLVDEL
ASASGVFQDEAEMLSQVELLKSQQIASAVVDQLKLDQNDAFLAGSPSLIRSARAAVGKLI
AVMRPELPVEEADMAARRREAAIDILQGGLDVQRVGRTYVLRLTYESPDPALAANIATAF
GSA
DOMAINcd557/750VSCVPGEGKSSVAASFGNLLALQGMRTLLIDGDIRNPGLTRSLQRKPELGLVEVMLEQAE
VDDVVLRDEPTPLALLPTVMRSRVTNTSDLLASASMGRLLQRFRGQFDYIVVDLPPVGPV
VDAKAFAQRVDAFVFVVEWGKTSRQLVRSAIASNPVFQTKSLGVILNKADSKKMRLYRSY
GSPEYYASRYESYY
SITE-696/-698GKT
SITEWalker A'584/591LLIDGDIR
SITEWalker B666/672IVVDLPP
SITEY Cluster733/750YRSYGSPEYYASRYESYY
SITEWalker A564/566GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAAHDTAASKAGKGSSGEFLNVERILAMVRRQIGIVIAAVVVGIAVGLVFLITAVPTYTASTDILIDKGQSKLVDELASA
                 EFLNVERILAMVRRQIGIVIAAVVVGIAVGLVFLITAVPTYTASTDILIDKGQSKLVDELASA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGVFQDEAEMLSQVELLKSQQIASAVVDQLKLDQNDAFLAGSPSLIRSARAAVGKLIAVMRPELPVEEADMAARRREAAI
SGVFQDEAEMLSQVELLKSQQIASAVVDQLKLDQNDAFLAGSPSLIRSARAAVGKLIAVMRPELPVEEADMAARRREAAI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DILQGGLDVQRVGRTYVLRLTYESPDPALAANIATAFGSAYLDDQLQAKYTATRRASTWLQDRIAELRQQSYDADLAVQK
DILQGGLDVQRVGRTYVLRLTYESPDPALAANIATAFGSA                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRNENGLLQTGTGLVSQQQLSEINTQLTAARAQTAQSKAQLDQIEQIIKDGRTDALVNDALVSTTINTLRAKYLDAARRQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEIASKLGPDHIQAVRLRAEMQEYERLIFGELRRIAESYRSTYAVSQERERSLEASLSEVTAVNADDNTLQVRLRELERE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAYRALYDDFLQRYQQTVQQQSFPITDARVISTAQVPDKPSAPRTPLVLALFAVMGAAAGAGIAGFREYRERFFRVGSQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRSELDMEFLGFLPILDPADAKTGEQKATPSQIWGPGALATHVRRHPMSSFAETLRNIKVAADLGMPDIPCKVIGVVSCV
                                                                            VSCV

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGEGKSSVAASFGNLLALQGMRTLLIDGDIRNPGLTRSLQRKPELGLVEVMLEQAEVDDVVLRDEPTPLALLPTVMRSRV
PGEGKSSVAASFGNLLALQGMRTLLIDGDIRNPGLTRSLQRKPELGLVEVMLEQAEVDDVVLRDEPTPLALLPTVMRSRV
   GKS                 LLIDGDIR                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNTSDLLASASMGRLLQRFRGQFDYIVVDLPPVGPVVDAKAFAQRVDAFVFVVEWGKTSRQLVRSAIASNPVFQTKSLGV
TNTSDLLASASMGRLLQRFRGQFDYIVVDLPPVGPVVDAKAFAQRVDAFVFVVEWGKTSRQLVRSAIASNPVFQTKSLGV
                         IVVDLPP                                                
       730       740       750  
....:....|....:....|....:....|..
ILNKADSKKMRLYRSYGSPEYYASRYESYYRD
ILNKADSKKMRLYRSYGSPEYYASRYESYY  
            YRSYGSPEYYASRYESYY  

© 1998-2019