BYKdb

Annotate results for A0A0Q5HN28

A0A0Q5HN28 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5HN28
DOMAINtad12/148AGLDLRDYLLVVRTYWKGIVSLTLLATMAAMGWTVLQPKVYASDSSGIVVTPGSDNVSLS
LAGDSLAKAKVKNYESVAKSRLVADRVISALQLNTSADALLGSISVKVPLDTAEIRVTAE
STDPATAQRVADAWVNG
DOMAINcd303/489TSSVQSEGKSTVTANLAVTMAAAGEKVVVVDGDLRRPTLVDVFNLVPGAGVTDVLAGTAE
LEDVLQPWSALPNLSVLGSGRIPPNPSELLGSRAMKNMLTALAQNATVLIDAPPLLPVTD
AAVLSRVADGAIVVIRTGKTTQDQLAQSLGNLDKVKGRVLGAVLNYVPTRGAGSYSYYGT
YTAAPEN
SITE-440/-442GKT
SITEWalker A'330/337VVVDGDLR
SITEWalker B410/416VLIDAPP
SITEY Cluster477/483YSYYGTY
SITEWalker A310/312GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSTAAPAEAPAGLDLRDYLLVVRTYWKGIVSLTLLATMAAMGWTVLQPKVYASDSSGIVVTPGSDNVSLSLAGDSLAKA
           AGLDLRDYLLVVRTYWKGIVSLTLLATMAAMGWTVLQPKVYASDSSGIVVTPGSDNVSLSLAGDSLAKA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVKNYESVAKSRLVADRVISALQLNTSADALLGSISVKVPLDTAEIRVTAESTDPATAQRVADAWVNGLAAQVEAIETAP
KVKNYESVAKSRLVADRVISALQLNTSADALLGSISVKVPLDTAEIRVTAESTDPATAQRVADAWVNG            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAEAGSEAASDAGTAAGATATAVRVLPLGKAVLPASPTSPNTKLNLALGALVGLAFGMAYAVIRRYLDRRIRDAAEIEQL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGVPAIGTLPVDHRLDARSTVLDAGMSANAHNGGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSVQSEGKSTVTANLAV
                                                              TSSVQSEGKSTVTANLAV
                                                                     GKS        
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMAAAGEKVVVVDGDLRRPTLVDVFNLVPGAGVTDVLAGTAELEDVLQPWSALPNLSVLGSGRIPPNPSELLGSRAMKNM
TMAAAGEKVVVVDGDLRRPTLVDVFNLVPGAGVTDVLAGTAELEDVLQPWSALPNLSVLGSGRIPPNPSELLGSRAMKNM
         VVVDGDLR                                                               
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTALAQNATVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGKTTQDQLAQSLGNLDKVKGRVLGAVLNYVPTRGAGSYSYY
LTALAQNATVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGKTTQDQLAQSLGNLDKVKGRVLGAVLNYVPTRGAGSYSYY
         VLIDAPP                                                            YSYY
       490       500       510       520 
....:....|....:....|....:....|....:....|.
GTYTAAPENAAGTAIPPLAAAQDEAMDGTLEAALTGRRARV
GTYTAAPEN                                
GTY                                      
© 1998-2019