BYKdb

Annotate results for A0A0Q5JKD6

A0A0Q5JKD6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q5JKD6
DOMAINcd268/460TSPLPGDGKSTIAANLAVSIAATGQSVVLIDADMRRPVVGGMFGFSDDVGLSDVLAGRAQ
IEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSQRMQSLARKLADDMVVIIDSPPTLAVAD
AAVIASWADGAVLVVTAGRTTDDMLTRATDNIAKTRGHLLGVVLNRMPLRGADSGYYGSQ
YGGYYGYGVPSSS
SITEWalker A275/277GKS
SITEWalker A'295/302VLIDADMR
SITEWalker B375/381VIIDSPP
SITEY Cluster443/454YYGSQYGGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVRVVRAYWKAIVALIVVGGLAGLGWSSLQPRVYTADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSVAET


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARGELGLSDSPESLVQRVRVSNPIETVNVRVDATGPTPESARDLAEAWIRGMTEEVDQLETGGGGQSAVRLVAGDSARLP


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAPSSPNVRLDVTLGALAGGVAGLIFAFVRRAFDRRVRSAHDITDAVDASVVGVLPVDKELAGGRAVFSFDDIKDGRGSF


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AHKEAMRELRTNLQYVDVDRPARVLVVTSPLPGDGKSTIAANLAVSIAATGQSVVLIDADMRRPVVGGMFGFSDDVGLSD
                           TSPLPGDGKSTIAANLAVSIAATGQSVVLIDADMRRPVVGGMFGFSDDVGLSD
                                  GKS                 VLIDADMR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSQRMQSLARKLADDMVVIIDSPPTLAVADAAVIASWADGAVL
VLAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSQRMQSLARKLADDMVVIIDSPPTLAVADAAVIASWADGAVL
                                                      VIIDSPP                   
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVTAGRTTDDMLTRATDNIAKTRGHLLGVVLNRMPLRGADSGYYGSQYGGYYGYGVPSSSPNGRWRLGLRRRGKKAEVVD
VVTAGRTTDDMLTRATDNIAKTRGHLLGVVLNRMPLRGADSGYYGSQYGGYYGYGVPSSS                    
                                          YYGSQYGGYYGY                          
       490       500       510       520       530       540    
....:....|....:....|....:....|....:....|....:....|....:....|....
AEQEATPRRRSGGLPPENVSGLRTLSQRRMSATAEGEATSEIAVASTAEPDTVDTMSRRRARRG


© 1998-2019