BYKdb

Annotate results for A0A0Q5L115

A0A0Q5L115 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5L115
DOMAINtad11/147RTLDLQDYLRIVRSYWLGAFLIVLLGVTAGAGWTLTQTRVYESSASGVVQVAAGGDANLA
FAADQLAKSQAQSYVELGGSLAVAESAAAALGGAASPASLLGRVTTSLPEDTAIITVTSR
GSTPADAAALTDAWLAA
DOMAINcd289/482TSPQPGDGKSTLAANLAESLAVSSDQRVVVIDCDLRRPTLSKVLGVSEGAGLTDVLSGRA
QLHQVMQQTEAASNLWVVGAGRIPPNPSELLGSQTFQDLVSTLAEHATVILDAPPVLAVT
DAVVLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVPTKGRDAREYGY
FGGSYYYYEGDVGT
SITEWalker A296/298GKS
SITEWalker A'317/324VVIDCDLR
SITEWalker B397/403VILDAPP
SITEY Cluster466/476YGYFGGSYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDRPDTEPRPRTLDLQDYLRIVRSYWLGAFLIVLLGVTAGAGWTLTQTRVYESSASGVVQVAAGGDANLAFAADQLAKSQ
          RTLDLQDYLRIVRSYWLGAFLIVLLGVTAGAGWTLTQTRVYESSASGVVQVAAGGDANLAFAADQLAKSQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQSYVELGGSLAVAESAAAALGGAASPASLLGRVTTSLPEDTAIITVTSRGSTPADAAALTDAWLAAMGEQIAAMQEEST
AQSYVELGGSLAVAESAAAALGGAASPASLLGRVTTSLPEDTAIITVTSRGSTPADAAALTDAWLAA             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTGGSATSFVALSSASVPTSPASPNVEVALLLGGLSGLMLAGVYLLVRNTLDRRIRSAAEVESRFGVGVIGTIPQNDALA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EHGGLVAALPNATADDRHVNFAMSEALRELRTNLAYVKVDAQPRVIVMTSPQPGDGKSTLAANLAESLAVSSDQRVVVID
                                                TSPQPGDGKSTLAANLAESLAVSSDQRVVVID
                                                       GKS                  VVID
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CDLRRPTLSKVLGVSEGAGLTDVLSGRAQLHQVMQQTEAASNLWVVGAGRIPPNPSELLGSQTFQDLVSTLAEHATVILD
CDLRRPTLSKVLGVSEGAGLTDVLSGRAQLHQVMQQTEAASNLWVVGAGRIPPNPSELLGSQTFQDLVSTLAEHATVILD
CDLR                                                                        VILD
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APPVLAVTDAVVLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVPTKGRDAREYGYFGGSYYYYEGDV
APPVLAVTDAVVLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVPTKGRDAREYGYFGGSYYYYEGDV
APP                                                              YGYFGGSYYYY    
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTGGAVGAGAGSGTAPASREAVTAPAPVVAPTPPAAPTPAPVPAPAGAAAAAAAAAAPGGEPAPARVPASPASPAAPTSP
GT                                                                              

       570       580      
....:....|....:....|....:.
AVPASPVEAPGGALTRREIRERERTR


© 1998-2019