BYKdb

Annotate results for A0A0Q5L7K3

A0A0Q5L7K3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5L7K3
DOMAINtad1/135MELRDYITVLRKGWVFIVAMMLVGVGLASAYSVVKTPDYSASAQVFVSTQTSGSVSDLAQ
GNTFTQQRVKTYASLVTTPIVLLPVISSLGLNTTAEQLAQSITASAPLDTTLIQVDVVSE
DPVMAADIANATSQS
DOMAINcd271/460TSSVQSEGKSTTVANLAIALDSAGARVILIDADLRRPRVGQYMGLEDAAGLTDLLIGRAD
LADVVQPWGRGQLHVLPAGQIPPNPSELLGSRAMQELIGQLEQQFDYVLFDAPPLLPVTD
AAILSKSASGAIVVVAAGKTHKGQLSGAVAALESVGAPIAGFVMTMMPTKGPDAYGYGRY
GGAYGYGIED
SITE-408/-410GKT
SITEWalker A'298/305ILIDADLR
SITEWalker B378/384VLFDAPP
SITEY Cluster445/456YGYGRYGGAYGY
SITEWalker A278/280GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYITVLRKGWVFIVAMMLVGVGLASAYSVVKTPDYSASAQVFVSTQTSGSVSDLAQGNTFTQQRVKTYASLVTTPI
MELRDYITVLRKGWVFIVAMMLVGVGLASAYSVVKTPDYSASAQVFVSTQTSGSVSDLAQGNTFTQQRVKTYASLVTTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVISSLGLNTTAEQLAQSITASAPLDTTLIQVDVVSEDPVMAADIANATSQSLTNVVEQIEATSEDADSEAGSQVKL
VLLPVISSLGLNTTAEQLAQSITASAPLDTTLIQVDVVSEDPVMAADIANATSQS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRVQEAQVPSAPTSPNVPLNLALGLLLGLAVGVGVAVLRHTLDNRVRNEADVEKISDAPIVGGIAFDPKADERPLIVQAD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRSPRAESFRTLRTNLQFLDLGTKSRTFVMTSSVQSEGKSTTVANLAIALDSAGARVILIDADLRRPRVGQYMGLEDAAG
                              TSSVQSEGKSTTVANLAIALDSAGARVILIDADLRRPRVGQYMGLEDAAG
                                     GKS                 ILIDADLR               
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTDLLIGRADLADVVQPWGRGQLHVLPAGQIPPNPSELLGSRAMQELIGQLEQQFDYVLFDAPPLLPVTDAAILSKSASG
LTDLLIGRADLADVVQPWGRGQLHVLPAGQIPPNPSELLGSRAMQELIGQLEQQFDYVLFDAPPLLPVTDAAILSKSASG
                                                         VLFDAPP                
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIVVVAAGKTHKGQLSGAVAALESVGAPIAGFVMTMMPTKGPDAYGYGRYGGAYGYGIEDDKETKAAKKERTRIGAEARK
AIVVVAAGKTHKGQLSGAVAALESVGAPIAGFVMTMMPTKGPDAYGYGRYGGAYGYGIED                    
                                            YGYGRYGGAYGY                        
   
...
AAR


© 1998-2019