BYKdb

Annotate results for A0A0Q5M6Z7

A0A0Q5M6Z7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0Q5M6Z7
DOMAINcd272/461TSSIPGEGKSTLTANLADAIASANSNVVVIDCDLRRPMQSTLFSLRSGVGLTDVLSGRVD
LNDALQAPSDSPHLRVLGAGRVPPNPSELLGSRTMRELVSALADVAIVILDAPPLLSVTD
AAIMGTIADGVVITVGAKQVTGEQLEKAYRSVVRVNGKVLGVVLNKIPPRGIDSHDYGYY
RSNYYTSNAD
SITEWalker A279/281GKS
SITEWalker A'299/306VVIDCDLR
SITEWalker B379/385VILDAPP
SITEY Cluster448/456YGYYRSNYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRDFVQLLRRYWVGELAIVMLTVGLVAALTAVQPRVYESTASGLTQAATGESLSMAFAGESLAKSRAESYVRVANSDAVA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRARKILGTDRSIGDLLGHIQASLPADTAVIEITARASTPDGAAKLANAWIAGLTKQVRALEAPEGAIAEPAISFVALAS


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARPPYFPSSPNVQTALVLAILAGIALAVVYGLLRQHFDRRIRSVEQIERLLGAPVIGTIPASPALEDRRRVTDSDSGDDA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VELFTISESLRELRTNLSYIDVDQPPKVIVVTSSIPGEGKSTLTANLADAIASANSNVVVIDCDLRRPMQSTLFSLRSGV
                               TSSIPGEGKSTLTANLADAIASANSNVVVIDCDLRRPMQSTLFSLRSGV
                                      GKS                 VVIDCDLR              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLTDVLSGRVDLNDALQAPSDSPHLRVLGAGRVPPNPSELLGSRTMRELVSALADVAIVILDAPPLLSVTDAAIMGTIAD
GLTDVLSGRVDLNDALQAPSDSPHLRVLGAGRVPPNPSELLGSRTMRELVSALADVAIVILDAPPLLSVTDAAIMGTIAD
                                                          VILDAPP               
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVVITVGAKQVTGEQLEKAYRSVVRVNGKVLGVVLNKIPPRGIDSHDYGYYRSNYYTSNADESGEAQPVASIEAGGDTSV
GVVITVGAKQVTGEQLEKAYRSVVRVNGKVLGVVLNKIPPRGIDSHDYGYYRSNYYTSNAD                   
                                               YGYYRSNYY                        
       490     
....:....|....:
DGQANEQRSRRASRS


© 1998-2019