BYKdb

Annotate results for A0A0Q5ME60

A0A0Q5ME60 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5ME60
DOMAINtad17/188DAIDLHALIAAFRRRLGLFTAIAAGVFLIVLALMLGQPPVYTATASLQINTRKEQVVAGQ
AVLSALDAEAAIVDTEVEVLKSPQLAAQVVQTLDLIRDPEFNARLRSSPLTRRLPRATPA
ATDPQIERQQVIDAVRRRLTVRRVGLTYSMAVSVTSESPIKAARIANAFADA
DOMAINcd538/725TSALPGEGKTTTAVCLARVAARSGGRVLLIDGDPRRRGVTRMLGLNPDHGLAEVLHGAAA
WRNVSVLDPDSGAQVLPLSGSGLSADDLFGAPPMNALLNELRQAFDLIVIDTAPVLVLAD
ARILAVKADTVILLARWRKTPARAVAAAIRILSQSGVRLSGVTLSQIDVRAEAGLGYGQA
DYDYRAYR
SITEWalker A545/547GKT
SITEWalker A'565/572LLIDGDPR
SITE-565/-571LLIDGDP
SITEY Cluster714/728YGQADYDYRAYRKYY
SITEWalker B645/651IVIDTAP
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTHYDTAIGGPGQPADDAIDLHALIAAFRRRLGLFTAIAAGVFLIVLALMLGQPPVYTATASLQINTRKEQVVAGQAVLS
                DAIDLHALIAAFRRRLGLFTAIAAGVFLIVLALMLGQPPVYTATASLQINTRKEQVVAGQAVLS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALDAEAAIVDTEVEVLKSPQLAAQVVQTLDLIRDPEFNARLRSSPLTRRLPRATPAATDPQIERQQVIDAVRRRLTVRRV
ALDAEAAIVDTEVEVLKSPQLAAQVVQTLDLIRDPEFNARLRSSPLTRRLPRATPAATDPQIERQQVIDAVRRRLTVRRV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLTYSMAVSVTSESPIKAARIANAFADAYLQSQLTAKFDANAQANTFLGARLEDLRRQVEAADAAVSAYRIENGLLSAQG
GLTYSMAVSVTSESPIKAARIANAFADA                                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATLTEQEISAYNQQLALARAQQAEQDARLRTARAQMAAGSNGDDVGEALSSPVVQNLRAQRAAISTRVADLSVRYGPLHP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMIRARQELSDIDAQIQAEIRRVVSNLDAQAQVARQRAASVQSSLDAARGALADNNAASVRLRELEGEAEAARAIYRAFL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRYRETSAQTGVEQADARIVSRATPPTAQSAPNLMISLALGLMLGAAAGNGAVIIANATQTGLSGPDDIERRLSVAAVGA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPLASSVATAEDQTLHPIDLVVQRPLSVFAEAFRALRTSITPIVSVVGEPSARIVAVTSALPGEGKTTTAVCLARVAARS
                                                         TSALPGEGKTTTAVCLARVAARS
                                                                GKT             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGRVLLIDGDPRRRGVTRMLGLNPDHGLAEVLHGAAAWRNVSVLDPDSGAQVLPLSGSGLSADDLFGAPPMNALLNELRQ
GGRVLLIDGDPRRRGVTRMLGLNPDHGLAEVLHGAAAWRNVSVLDPDSGAQVLPLSGSGLSADDLFGAPPMNALLNELRQ
    LLIDGDPR                                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFDLIVIDTAPVLVLADARILAVKADTVILLARWRKTPARAVAAAIRILSQSGVRLSGVTLSQIDVRAEAGLGYGQADYD
AFDLIVIDTAPVLVLADARILAVKADTVILLARWRKTPARAVAAAIRILSQSGVRLSGVTLSQIDVRAEAGLGYGQADYD
    IVIDTAP                                                              YGQADYD
       730
....:....|
YRAYRKYYAA
YRAYR     
YRAYRKYY  

© 1998-2019