BYKdb

Annotate results for A0A0Q5MS06

A0A0Q5MS06 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5MS06
DOMAINtad13/149AGLDLADYLRVVRTYWKAIVAFTLLATLTAFGWTVLQPKIYSSDSSGIVVTPGSDNVSLS
LAGDSLAKAKVKNYESVAKSRLVADRVIASLELKTTADALLGTISVKVPLDTAEIRVTAQ
SPDPATAQRVADAWVNG
DOMAINcd311/497TSSMQAEGKSTVTANLAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAE
LEDVLQPWGALPNLSVLGSGRIPPNPSELLGSKAMKNMLNALAENAIVLIDAPPLLPVTD
AAVLSRVADGAIVVIRTGRTTQEQLGQSLGNLEKVKGRILGAVLNYVPTKGTDAYSYYGT
YTSATGS
SITEWalker A318/320GKS
SITEWalker A'338/345VVVDGDLR
SITEWalker B418/424VLIDAPP
SITEY Cluster485/491YSYYGTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVNTVPAGETPAGLDLADYLRVVRTYWKAIVAFTLLATLTAFGWTVLQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAK
            AGLDLADYLRVVRTYWKAIVAFTLLATLTAFGWTVLQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKVKNYESVAKSRLVADRVIASLELKTTADALLGTISVKVPLDTAEIRVTAQSPDPATAQRVADAWVNGLAAQVEAIETA
AKVKNYESVAKSRLVADRVIASLELKTTADALLGTISVKVPLDTAEIRVTAQSPDPATAQRVADAWVNG           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPETATTETTTPDAGTSPDAATAPAATASAVRILPLGKAVLPTSPVSPNVKLTLALGALIGLALGVAYALVRRHLDRRIR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAAEIERLFEVPVIGTLPIDHRLDEKSTILDAGAAAQLHDAGGAMAEALRELRTNISFLDVDQPPRIIVVTSSMQAEGKS
                                                                      TSSMQAEGKS
                                                                             GKS
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVTANLAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELEDVLQPWGALPNLSVLGSGRIPPNPSELL
TVTANLAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELEDVLQPWGALPNLSVLGSGRIPPNPSELL
                 VVVDGDLR                                                       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSKAMKNMLNALAENAIVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLGQSLGNLEKVKGRILGAVLNYVPTK
GSKAMKNMLNALAENAIVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLGQSLGNLEKVKGRILGAVLNYVPTK
                 VLIDAPP                                                        
       490       500       510       520       530       540  
....:....|....:....|....:....|....:....|....:....|....:....|..
GTDAYSYYGTYTSATGSAPDYHSAPESLAPEAFVDDTFQSQIQRKNDDDVLEPVPAGRRARG
GTDAYSYYGTYTSATGS                                             
    YSYYGTY                                                   
© 1998-2019