BYKdb

Annotate results for A0A0Q5N0H1

A0A0Q5N0H1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5N0H1
DOMAINtad1/137MTPLDLLGALRRSALLVVAITLVGIALGAAAVAMTAPLYTSSTLLFVSVRSAATTTAGEL
VQGNAAAQQKVQSYVGVATSPRVLQPVVDDLDDETTLSSLAPQVSAETPVGTVNIRITVV
DADPSRAARLAGAIAES
DOMAINcd270/459TSALPAEGKTTTVANLAVALSETGSRVIVVDTDLRLPRLAELLGLEGAVGVSDVLLGRAD
LADAVQPWGRGGLAVLPAGTLPPNPSELLGSNRMADLLGELARHYDHVLLDAPPLLPVTD
AAVLSRLADGAIVVAAAGRATRGQLATALETLSSLGATSFGVVATMLRPTGPQSYGYGYG
YTAPRTAPEA
SITEWalker A277/279GKT
SITEWalker A'297/304IVVDTDLR
SITEWalker B377/383VLLDAPP
SITEY Cluster444/450YGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPLDLLGALRRSALLVVAITLVGIALGAAAVAMTAPLYTSSTLLFVSVRSAATTTAGELVQGNAAAQQKVQSYVGVATS
MTPLDLLGALRRSALLVVAITLVGIALGAAAVAMTAPLYTSSTLLFVSVRSAATTTAGELVQGNAAAQQKVQSYVGVATS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRVLQPVVDDLDDETTLSSLAPQVSAETPVGTVNIRITVVDADPSRAARLAGAIAESFRTVVVDELETPAPGGTSLVGVE
PRVLQPVVDDLDDETTLSSLAPQVSAETPVGTVNIRITVVDADPSRAARLAGAIAES                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLAPPVVATTPSSPDLVVDLLLGGLVGLCAGVAAAALRARLDTRIRNRADIEAVTGGPVLGALAFDRDAGQRPLVVAVDP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSPFAESFRALRTSVQFIGLDRTARCLVVTSALPAEGKTTTVANLAVALSETGSRVIVVDTDLRLPRLAELLGLEGAVGV
                             TSALPAEGKTTTVANLAVALSETGSRVIVVDTDLRLPRLAELLGLEGAVGV
                                    GKT                 IVVDTDLR                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDVLLGRADLADAVQPWGRGGLAVLPAGTLPPNPSELLGSNRMADLLGELARHYDHVLLDAPPLLPVTDAAVLSRLADGA
SDVLLGRADLADAVQPWGRGGLAVLPAGTLPPNPSELLGSNRMADLLGELARHYDHVLLDAPPLLPVTDAAVLSRLADGA
                                                        VLLDAPP                 
       410       420       430       440       450       460    
....:....|....:....|....:....|....:....|....:....|....:....|....
IVVAAAGRATRGQLATALETLSSLGATSFGVVATMLRPTGPQSYGYGYGYTAPRTAPEADPATA
IVVAAAGRATRGQLATALETLSSLGATSFGVVATMLRPTGPQSYGYGYGYTAPRTAPEA     
                                           YGYGYGY              
© 1998-2019