BYKdb

Annotate results for A0A0Q5PG86

A0A0Q5PG86 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5PG86
DOMAINtad4/179APPPLLQYWQIVLRWKWIILGIIAAAFTVGLIVTLLTSPQYSATSRIEISREQKKFTNVE
GVDSPISDRDLEFYQTQYSLLQARSLAERVARTLRLSTNEEFFAAHGVDLSGSLFTSGAA
QKSGAAETARREKMAVDLLLDHIAVSPVRGSSLVDIRYVSGSPTISAQIANSWTQQ
DOMAINcd519/708TSTRASEGKSTTSFALAMVLGRTGKRVLLLDADMRSPSMHSFAGLPNVTGLSNYLAGADN
WHETLLETPSRGVTLMPSGPTPPSAAELLSSDRITTLIRQASEQFDHIVIDSPPILGLAD
APLLTRAVEGIVFVVEADGVPIRGIKTSLARLQAVHAHVFGVVLTKLQSRLSSYGYGYGY
SYGYGSNDRD
SITEWalker A526/528GKS
SITEWalker A'546/553LLLDADMR
SITEWalker B626/632IVIDSPP
SITEY Cluster692/702YGYGYGYSYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVLAPPPLLQYWQIVLRWKWIILGIIAAAFTVGLIVTLLTSPQYSATSRIEISREQKKFTNVEGVDSPISDRDLEFYQTQ
   APPPLLQYWQIVLRWKWIILGIIAAAFTVGLIVTLLTSPQYSATSRIEISREQKKFTNVEGVDSPISDRDLEFYQTQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YSLLQARSLAERVARTLRLSTNEEFFAAHGVDLSGSLFTSGAAQKSGAAETARREKMAVDLLLDHIAVSPVRGSSLVDIR
YSLLQARSLAERVARTLRLSTNEEFFAAHGVDLSGSLFTSGAAQKSGAAETARREKMAVDLLLDHIAVSPVRGSSLVDIR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVSGSPTISAQIANSWTQQFVAQSIDRRFASTTDARQFLEGRLADLRVKLETSERDLVNYAAQKGIVALGRTKDADGRTQ
YVSGSPTISAQIANSWTQQ                                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDRTLVSSDLEALNAALATATAERIAAESRAHQQSGGANADALSNPTINDLRQKRTEIAAEYAKLMVRFEPDYPSAKELA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQLRTVDAGIAREESRVLNSRSSDYQSAVLRENALRRRVEQLKSGLSRQQQDSIQYNIYQREADTNRQLYDGLLQRYKEI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVAGVGANNIAIVDPARVPDSPSSPNFLINLALALVAGLGLAAIATFALNQIDEGLRDPTQVGRILQVPLLGSVPTSEGS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTLTELQDTKSALSEAYLSIRSNLAFSTDHGIPRALMVTSTRASEGKSTTSFALAMVLGRTGKRVLLLDADMRSPSMHSF
                                      TSTRASEGKSTTSFALAMVLGRTGKRVLLLDADMRSPSMHSF
                                             GKS                 LLLDADMR       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGLPNVTGLSNYLAGADNWHETLLETPSRGVTLMPSGPTPPSAAELLSSDRITTLIRQASEQFDHIVIDSPPILGLADAP
AGLPNVTGLSNYLAGADNWHETLLETPSRGVTLMPSGPTPPSAAELLSSDRITTLIRQASEQFDHIVIDSPPILGLADAP
                                                                 IVIDSPP        
       650       660       670       680       690       700         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
LLTRAVEGIVFVVEADGVPIRGIKTSLARLQAVHAHVFGVVLTKLQSRLSSYGYGYGYSYGYGSNDRDA
LLTRAVEGIVFVVEADGVPIRGIKTSLARLQAVHAHVFGVVLTKLQSRLSSYGYGYGYSYGYGSNDRD 
                                                   YGYGYGYSYGY       

© 1998-2019