BYKdb

Annotate results for A0A0Q5RU45

A0A0Q5RU45 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5RU45
DOMAINtad1/135MELRDYITVLRKGWVLILVLALVGVAAAAGFSLVKKPVYSASAQVFVSTETSGSASDLAQ
GNTFTQQRVLTYSNLVSTPIVLLPVISSLKLDMNADQLATMVTATAPTSTTLISISVNDT
DPVQAANIANATSQS
DOMAINcd267/454TSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMEVEGSAGLTDVLIGRAE
LEDVAHPWGRGNLVVLPAGPIPPNPSELLGSLAMQDLIARLEGQFDYVLFDAPPLLPVTD
AAILSKKASGAILAVASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVKGPGAYGYGRY
GYGYGYGT
SITE-404/-406GKT
SITEWalker A'294/301ILIDADLR
SITEWalker B374/380VLFDAPP
SITEY Cluster441/452YGYGRYGYGYGY
SITEWalker A274/276GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLVKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLVKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLPVISSLKLDMNADQLATMVTATAPTSTTLISISVNDTDPVQAANIANATSQSLTNVVQDIEATDANGASTVKLTRVK
VLLPVISSLKLDMNADQLATMVTATAPTSTTLISISVNDTDPVQAANIANATSQS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QADVPSKPISPNVPVNVALGLLVGLALGIGIAVLRETLDNRVRTELDVEKISEKPVVGGIAFDSKASERPLIVQVDPRSP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAESFRTLRTNLQFLDLGTGSRTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMEVEGSAGLTDV
                          TSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMEVEGSAGLTDV
                                 GKS                 ILIDADLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIGRAELEDVAHPWGRGNLVVLPAGPIPPNPSELLGSLAMQDLIARLEGQFDYVLFDAPPLLPVTDAAILSKKASGAILA
LIGRAELEDVAHPWGRGNLVVLPAGPIPPNPSELLGSLAMQDLIARLEGQFDYVLFDAPPLLPVTDAAILSKKASGAILA
                                                     VLFDAPP                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVKGPGAYGYGRYGYGYGYGTGQDDDKAPAAVKPPKRPGKLSALRRA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVKGPGAYGYGRYGYGYGYGT                          
                                        YGYGRYGYGYGY                            
  
..
ER


© 1998-2019