BYKdb

Annotate results for A0A0Q5SIU7

A0A0Q5SIU7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5SIU7
DOMAINtad1/135MTDIFRALLAGWYLLLIGLVVGGGAGVAISASATPTYVSSTKLFVAVRGQADTTAMEIAS
GSNAAQQKIKTYTSLVTTPRVLDPVVRDVGSPLTLESLAAEVSASSPTASTIMSVTVSDV
DPRRAAELADAVTES
DOMAINcd268/457TSAGPGEGKTTTTANLAVALAETGLRVVIVDADMRRPNLAKVLGIEGAVGLSDLLIGRVE
LDDVLQPWGSDALGVLPAGDVPPNPSELLGSVAMKALLDDLGSRYAVVLIDTPPLLSVTD
AVLLSEMVTSMLLVVASGRTQRTHVKKALERLDAVGETPRAAVLSMSPRRRSDTRYQYYG
EASGAPRGLR
SITEWalker A275/277GKT
SITEWalker A'295/302VIVDADMR
SITEWalker B375/381VLIDTPP
SITEY Cluster443/446YQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTDIFRALLAGWYLLLIGLVVGGGAGVAISASATPTYVSSTKLFVAVRGQADTTAMEIASGSNAAQQKIKTYTSLVTTPR
MTDIFRALLAGWYLLLIGLVVGGGAGVAISASATPTYVSSTKLFVAVRGQADTTAMEIASGSNAAQQKIKTYTSLVTTPR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDPVVRDVGSPLTLESLAAEVSASSPTASTIMSVTVSDVDPRRAAELADAVTESLRSVVTTELEPEFAPGVPSVTMEVV
VLDPVVRDVGSPLTLESLAAEVSASSPTASTIMSVTVSDVDPRRAAELADAVTES                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPAAVSSSPATPHTTANVALGLALGLAVGALGALLRTVLDTKVRGQDDLADEHDLAVVGDIPFDPEVRRRPVVVGDGGGS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INAEAFRMLRTNIRFLASGASARTFAVTSAGPGEGKTTTTANLAVALAETGLRVVIVDADMRRPNLAKVLGIEGAVGLSD
                           TSAGPGEGKTTTTANLAVALAETGLRVVIVDADMRRPNLAKVLGIEGAVGLSD
                                  GKT                 VIVDADMR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIGRVELDDVLQPWGSDALGVLPAGDVPPNPSELLGSVAMKALLDDLGSRYAVVLIDTPPLLSVTDAVLLSEMVTSMLL
LLIGRVELDDVLQPWGSDALGVLPAGDVPPNPSELLGSVAMKALLDDLGSRYAVVLIDTPPLLSVTDAVLLSEMVTSMLL
                                                      VLIDTPP                   
       410       420       430       440       450       460      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
VVASGRTQRTHVKKALERLDAVGETPRAAVLSMSPRRRSDTRYQYYGEASGAPRGLRRLIRSKGRS
VVASGRTQRTHVKKALERLDAVGETPRAAVLSMSPRRRSDTRYQYYGEASGAPRGLR         
                                          YQYY                    
© 1998-2019