BYKdb

Annotate results for A0A0Q5WCK0

A0A0Q5WCK0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q5WCK0
DOMAINtad1/176MLGIARRQWRVVAAAAFLAALAGLLYVMTAVPLYTADISVLLDAEKNQLVEELSMSGAGL
EDETALLSQIEVLTSETIGLAVVDKLKLGEDPIFMAEPRSILGTVLAPVRALMNIPKWFA
SNQVEDDAQARRAQAQLILSRNMSVDRVGKTYVLRIGYTSPSPQMAARIANAIGDA
DOMAINcd536/727VSTLPGEGKSTVSTNFAELLASQGNRTVLIDADLRNPGTTRMLARHAQAGILEILLDDKA
PQDVLLSNPRTKLAFLPAVIKHRVPHSSELLISPAMRGLIAKLSQHFDYIIVDLPPIGPV
VDARAMASTIIDGFIYVVEWGQTARRVVRHTLNTEPQIASKCLGVILNKVDNEKMKLYRS
YGSSEYYHSRYS
SITEWalker A543/545GKS
SITEWalker A'563/570VLIDADLR
SITEWalker B645/651IIVDLPP
SITEY Cluster713/730YRSYGSSEYYHSRYSQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLGIARRQWRVVAAAAFLAALAGLLYVMTAVPLYTADISVLLDAEKNQLVEELSMSGAGLEDETALLSQIEVLTSETIGL
MLGIARRQWRVVAAAAFLAALAGLLYVMTAVPLYTADISVLLDAEKNQLVEELSMSGAGLEDETALLSQIEVLTSETIGL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVVDKLKLGEDPIFMAEPRSILGTVLAPVRALMNIPKWFASNQVEDDAQARRAQAQLILSRNMSVDRVGKTYVLRIGYTS
AVVDKLKLGEDPIFMAEPRSILGTVLAPVRALMNIPKWFASNQVEDDAQARRAQAQLILSRNMSVDRVGKTYVLRIGYTS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSPQMAARIANAIGDAYVVDKLNSKYESTRRASAWLQERIVELRQKALETDLAVQKFRTANGLVSTGSQLVSDQQLSELN
PSPQMAARIANAIGDA                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TALITAQAETAKARARLDRIQSIVSSGQSDAIVTDVLDSSVSTELRKKYLDSAKLEGEISKKLGPNHVQAVRLRAEMAEY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRLMFEEVNRIAESYRSEVDVAAAREKSLQDSVSKATNISATANETQVQLRELERESDTYRTLYQTFLQRYQEAVQQQSF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVTEARIISSASAPEKASFPRKPLVLALFVVMGAAAGTGVGAFREFRDRFFRTGDQVRDILKQEYLGAAPLVIESKQPRN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALQVGEVNPRLINKQSSISDYVLDNPLSAFAETLRSAKIAADLSILSNKCKVIGIVSTLPGEGKSTVSTNFAELLASQGN
                                                       VSTLPGEGKSTVSTNFAELLASQGN
                                                              GKS               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTVLIDADLRNPGTTRMLARHAQAGILEILLDDKAPQDVLLSNPRTKLAFLPAVIKHRVPHSSELLISPAMRGLIAKLSQ
RTVLIDADLRNPGTTRMLARHAQAGILEILLDDKAPQDVLLSNPRTKLAFLPAVIKHRVPHSSELLISPAMRGLIAKLSQ
  VLIDADLR                                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HFDYIIVDLPPIGPVVDARAMASTIIDGFIYVVEWGQTARRVVRHTLNTEPQIASKCLGVILNKVDNEKMKLYRSYGSSE
HFDYIIVDLPPIGPVVDARAMASTIIDGFIYVVEWGQTARRVVRHTLNTEPQIASKCLGVILNKVDNEKMKLYRSYGSSE
    IIVDLPP                                                             YRSYGSSE
       730   
....:....|...
YYHSRYSQYYQEG
YYHSRYS      
YYHSRYSQYY   

© 1998-2019