BYKdb

Annotate results for A0A0Q6AAN2

A0A0Q6AAN2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q6AAN2
DOMAINtad43/207AGFDPRAIWAVVYRNRLVMILIVALALVLGVVSIMVTPRIYQARSSVQIDQQVAKVLGTE
DSEPATAGGDADRFLQTQVDVINSRAMAKRVSDSLGLAANDAFLESMGGRAKLPVPGERR
IDQVLDTLQNNLNVDLRRNSRVVGVQFKSRDPALAARIANSYANN
DOMAINcd551/740TSSQMAEGKSTTSYALARDFASIGHKVLLVDADLRRPSLHRLMNMSAADKGLSTVLARMT
PVEDAVVSTDTDNLSFLPAGPLPPDPANLFAGTVPADLLAKLGERYDLIVLDGPPVLALA
DATALASSAAATVIIAEAGGAHYGQVRNAITRLVRAQGHVLGCIVTKYNRRKSGYAATGN
YYRYDYRAKE
SITEWalker A558/560GKS
SITEWalker A'578/585LLVDADLR
SITEWalker B659/665IVLDGPP
SITEY Cluster725/736YAATGNYYRYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMQQATGGFDTAPDRTIGPRDTGRHAAAAGDDPSLLPDAEDEAGFDPRAIWAVVYRNRLVMILIVALALVLGVVSIMVTP
                                          AGFDPRAIWAVVYRNRLVMILIVALALVLGVVSIMVTP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIYQARSSVQIDQQVAKVLGTEDSEPATAGGDADRFLQTQVDVINSRAMAKRVSDSLGLAANDAFLESMGGRAKLPVPGE
RIYQARSSVQIDQQVAKVLGTEDSEPATAGGDADRFLQTQVDVINSRAMAKRVSDSLGLAANDAFLESMGGRAKLPVPGE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRIDQVLDTLQNNLNVDLRRNSRVVGVQFKSRDPALAARIANSYANNFIESNIQRKFSTSAYSREFLQNQLGLAKGRLEA
RRIDQVLDTLQNNLNVDLRRNSRVVGVQFKSRDPALAARIANSYANN                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SERSLINYARSAQLIDASTGARRTGQPDGPQSLVTANLVQLNESYATAAAARVQAQQRYEQARATPLLSLPDVLSNPAAQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EMLQRRAELNGQLNQLRERLKPDHPTVIQATAQLDALNAQLNQLAGSILASIRNQYLTAQRQQDAIDRQVSGLKSATLAE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDRGVQYNIFKREVDTNRQLYESLLQRFKEVSAEAGVATNNITLVDSAEAPRRPTSPRPLVNMALALVAGVFLAGLYAFG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RERLDDAIRDPRDVETKLHLPLLGVVPEQEEGDPLVALRDTKSEIAEAYYAIRTSLELSSNQGLPRSLLVTSSQMAEGKS
                                                                      TSSQMAEGKS
                                                                             GKS
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTSYALARDFASIGHKVLLVDADLRRPSLHRLMNMSAADKGLSTVLARMTPVEDAVVSTDTDNLSFLPAGPLPPDPANLF
TTSYALARDFASIGHKVLLVDADLRRPSLHRLMNMSAADKGLSTVLARMTPVEDAVVSTDTDNLSFLPAGPLPPDPANLF
                 LLVDADLR                                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGTVPADLLAKLGERYDLIVLDGPPVLALADATALASSAAATVIIAEAGGAHYGQVRNAITRLVRAQGHVLGCIVTKYNR
AGTVPADLLAKLGERYDLIVLDGPPVLALADATALASSAAATVIIAEAGGAHYGQVRNAITRLVRAQGHVLGCIVTKYNR
                  IVLDGPP                                                       
       730       740
....:....|....:....|
RKSGYAATGNYYRYDYRAKE
RKSGYAATGNYYRYDYRAKE
    YAATGNYYRYDY    

© 1998-2019