BYKdb

Annotate results for A0A0Q6CX52

A0A0Q6CX52 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0Q6CX52
DOMAINtad9/190SFVDLDHIFAMVRRQLWVVLVGLVIGAMVGVAYLLSAVPLYTATSDILIDKGQSKIVDEL
ASASGVFQDEAEMLSQVELLKSDQIADGVEKRLSLSENAVFMAGNPSVLRSAILGIKSLV
ALVTGDDALDLDEEATTREEAKALLQKNLTVERVGQTYVLRLGYTSVDPELAARITAAYG
EA
DOMAINcd544/737VSCMPTEGKSTISANLGCLLAMQGAKTLLIDGDLRNPGLSRMMAKKPDAGVVEVVLGQAP
ANATILADSDEKLSLLPTILKRRVANTAEILASPSMANLLTGFRSEYDYVVVDLPPLGPV
VDAKAFAGRVDAFVFVIEWGRTSRMLVRNILMNNPVFHEKCLGVILNKADNSKMKFYRSY
GSPEYYASRYNSYY
SITEWalker A551/553GKS
SITEWalker A'571/578LLIDGDLR
SITEWalker B653/659VVVDLPP
SITE-650/-652YDY
SITEY Cluster720/737YRSYGSPEYYASRYNSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASDHGGSSFVDLDHIFAMVRRQLWVVLVGLVIGAMVGVAYLLSAVPLYTATSDILIDKGQSKIVDELASASGVFQDEAE
        SFVDLDHIFAMVRRQLWVVLVGLVIGAMVGVAYLLSAVPLYTATSDILIDKGQSKIVDELASASGVFQDEAE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLSQVELLKSDQIADGVEKRLSLSENAVFMAGNPSVLRSAILGIKSLVALVTGDDALDLDEEATTREEAKALLQKNLTVE
MLSQVELLKSDQIADGVEKRLSLSENAVFMAGNPSVLRSAILGIKSLVALVTGDDALDLDEEATTREEAKALLQKNLTVE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVGQTYVLRLGYTSVDPELAARITAAYGEAYLDDQLQAKYEATRRASGWLQDRIAELKEQSYNADLAVQQFRNDNGLIAS
RVGQTYVLRLGYTSVDPELAARITAAYGEA                                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEQLVSQQQLNQINSQLIESQAQTSESKARLDQINAIIATGRTDSVVGDALSSQTINTLRDKYLDTARRETEIRGKLGSG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HVQAVRLRSEMKEYERLIFGELRRIADSYQSNYTVALEREKSLEASLARVVSVNASDNTMQVKLRELERESETFKSLYDN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FLQRYQQTVQQQSFPITDARIITPASVPDKPSAPKTPIVLAMFMALGVAAGTGSAALREYRDRFFRVGAQVRTELETEFL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GYTPIVKSQTTRTDAVVPSLWAPGGMAAYVRQHPMSGFTETLRNVKVAVDLAMPDLSCKVIGVVSCMPTEGKSTISANLG
                                                               VSCMPTEGKSTISANLG
                                                                      GKS       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CLLAMQGAKTLLIDGDLRNPGLSRMMAKKPDAGVVEVVLGQAPANATILADSDEKLSLLPTILKRRVANTAEILASPSMA
CLLAMQGAKTLLIDGDLRNPGLSRMMAKKPDAGVVEVVLGQAPANATILADSDEKLSLLPTILKRRVANTAEILASPSMA
          LLIDGDLR                                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLLTGFRSEYDYVVVDLPPLGPVVDAKAFAGRVDAFVFVIEWGRTSRMLVRNILMNNPVFHEKCLGVILNKADNSKMKFY
NLLTGFRSEYDYVVVDLPPLGPVVDAKAFAGRVDAFVFVIEWGRTSRMLVRNILMNNPVFHEKCLGVILNKADNSKMKFY
            VVVDLPP                                                            Y
       730         
....:....|....:....
RSYGSPEYYASRYNSYYTD
RSYGSPEYYASRYNSYY  
RSYGSPEYYASRYNSYY  

© 1998-2019